@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 669_tII_BRADI: (2014-05-12 )
AGGCNAGQLSVCAVAITSGSPPSAECCSNLRAQQGCLCQYAKDPNYGRYISSPYARQTVASCGIPVPKC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




1 HHSearch 96.1769%-127 - C4 -1N89 4.9 NLT2G_WHEAT
14 Fugue 94.6966%-132 - C4 -1L6H - NLTPX_ORYSJ -
2 HHSearch 94.4166%-132 - C4 -1L6H - NLTPX_ORYSJ -
24 SP3 94.3865%-132 - C4 -1L6H - NLTPX_ORYSJ -
15 Fugue 79.8430%-112 - C4 -2RKN - DIRL1_ARATH -
3 HHSearch 76.7728%-122 - C4 -2RKN - DIRL1_ARATH -
8 HHSearch 70.6223% -91 - C4 -1SIY - NLTP1_VIGRR -
25 SP3 69.0224% -94 - C4 -1FK5 - NLTP_MAIZE -
9 HHSearch 68.0129%-105 - C4 -1T12 - NLTP1_TOBAC -
6 HHSearch 62.7923% -76 - C4 -1BWO - NLTP1_WHEAT -
5 HHSearch 60.7423% -89 - C4 -2ALG - NLTP1_PRUPE -
17 Fugue 60.5917% -92 - C4 -1S6D - 2SS8_HELAN -
7 HHSearch 59.2727% -91 - C4 -1AFH - NLTP_MAIZE -
10 HHSearch 54.3425%-102 - C4 -1HYP - HPSE_SOYBN -
29 SP3 53.9018%-112 - C4 -1PS6 - PDXA_ECOLI -
18 Fugue 53.2811%-106 - C4 -1VD2 - KPCI_HUMAN -
26 SP3 51.2914% -97 * C4 *1U78 - TC3A_CAEEL -
27 SP3 50.6517% -76 - C4 -1KNG - CYCY_BRADU -
28 SP3 47.7714% -97 - C4 -1F9M - TRXF_SPIOL -
19 Fugue 43.8217% -62 - C3 -1CWV - -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




39 99.14100%-136 - C- -M039 - -
41 92.66100%-121 - C- -M041 - -