@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 751_tIV_VITVI: (2014-05-14 )
QTICNMSGEGLMACKPAVSPPNPAPPSAACCSALSHADMHCLCSYRNSKLLPSMGIDPNLALQLPKKCKFPNAAHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]
11 HHSearch 99.4354%-141 - C3 -2RKN - DIRL1_ARATH -
1 Fugue 99.0053%-141 - C3 -2RKN 6.0 DIRL1_ARATH
34 SP3 70.1622%-136 - C3 -1HSS - IAA1_WHEAT -
23 HHSearch 65.3824% -90 - C3 -1HSS - IAA1_WHEAT -
19 HHSearch 65.0429%-114 - C3 -2ALG - NLTP1_PRUPE -
17 HHSearch 63.5826% -93 - C3 -1SIY - NLTP1_VIGRR -
18 HHSearch 63.1922%-117 - C3 -1T12 - NLTP1_TOBAC -
12 HHSearch 61.6027%-114 - C3 -1N89 - NLT2G_WHEAT -
24 HHSearch 59.0020% -98 - C3 -1BEA - ITRF_MAIZE -
32 SP3 58.7722% -96 - C3 -1FK5 - NLTP_MAIZE -
28 HHSearch 57.5020% -95 - C3 -1B1U - IAAT_ELECO -
40 SP3 57.2719%-127 - C3 -1BEA - ? -
14 HHSearch 56.3024% -90 - C3 -1AFH - NLTP_MAIZE -
16 HHSearch 55.6519% -88 - C3 -1BWO - NLTP1_WHEAT -
37 SP3 55.0815%-139 - C3 -1HYP - ? -
22 HHSearch 54.0024% -98 - C3 -1S6D - 2SS8_HELAN -
26 HHSearch 53.3522% -96 * C3 *1SM7 - ? -
27 HHSearch 53.2121% -97 - C3 -2LVF - ? -
2 Fugue 51.3926%-108 - C3 -1L6H - NLTPX_ORYSJ -
20 HHSearch 51.1228% -98 - C3 -2DS2 - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]
42 100.00100%-155 - C- -M042 - -
43 98.06100%-168 - C- -M043 - -
45 96.19100%-159 - C- -M045 - -