@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-14 )
ITCSDVNKALAPCVSYLTGGGAPTSACCDGVRTLKSLSPTTSDRQTACQCAKDAASRNPNIREDAAAALPNKCGVQTDIPISRSTDCSTVS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]
21 HHSearch 87.3649% -94 - C3 -2ALG 2.6 NLTP1_PRUPE
11 SP3 86.2247% -84 - C3 -1FK5 5.0 NLTP_MAIZE
22 HHSearch 85.6649% -87 - C3 -1T12 - NLTP1_TOBAC -
26 HHSearch 82.9544% -88 - C3 -1BWO - NLTP1_WHEAT -
23 HHSearch 82.7047% -80 - C3 -1AFH - NLTP_MAIZE -
24 HHSearch 77.8941% -85 - C3 -1SIY - NLTP1_VIGRR -
32 HHSearch 57.1720%-100 - C3 -1BEA - ITRF_MAIZE -
14 SP3 57.0319% -91 - C3 -1QPO - NADC_MYCTU -
35 HHSearch 56.2824% -86 - C3 -1SM7 - ? -
19 SP3 55.5319% -88 - C3 -1QPO - NADC_MYCTU -
38 HHSearch 54.5318% -82 - C3 -1HSS - IAA1_WHEAT -
17 SP3 51.0017% -90 - C3 -1HSS - IAA1_WHEAT -
40 HHSearch 50.2215% -59 - C3 -1W2Q - CONG_ARAHY -
36 HHSearch 49.3824% -55 - C3 -1PSY - 2SS_RICCO -
27 HHSearch 49.0920% -90 - C3 -2RKN - DIRL1_ARATH -
39 HHSearch 48.8520% -93 - C3 -1S6D - 2SS8_HELAN -
2 Fugue 48.5520% -76 - C3 -2RKN - DIRL1_ARATH -
33 HHSearch 44.3214% -79 - C3 -1B1U - IAAT_ELECO -
7 Fugue 44.2717% -15 - C1 -3IYU - ? -
29 HHSearch 42.7232% -48 - C3 -1N89 - NLT2G_WHEAT -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]
41 96.41100% -92 - C- -M041 - -
45 96.12100% -90 - C- -M045 - -
48 93.87100%-106 - C- -M048 - -
46 92.98100% -85 - C- -M046 - -