Study : 777_tI_MEDTR (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 1 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: DAO_E_5(2ALG) / Model_23(2ALG/A) = [4.7] Download733.9237.05APSCPAVAQTLTPCLPHVSNPGPSPPQPCCNRVKTLNSQAKTTQDRHHVCGCLKSLMAGIPGLNLPAFASVAKDCGVDIGYIISPNTDCSK
Consensus
[pKd Mean = 4.70]
-733
(s=0)
37
(s=0)
APSCPAVAQTLTPCLPHVSNPGPSPPQPCCNRVKTLNSQAKTTQDRHHVCGCLKSLMAGIPGLNLPAFASVAKDCGVDIGYIISPNTDCSK