@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR1C1_PPARa: (2016-04-07 )
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Atome Classification :

(201 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

S44_A_2(2ZNN)
PPARA_HUMAN
[Raw transfer]




IL2_A_3(3SP6)
PPARA_HUMAN
[Raw transfer]




2PQ_A_3(3GBK)
PPARG_HUMAN
[Raw transfer]




IL2_B_4(3SP9)
PPARD_HUMAN
[Raw transfer]




MMB_A_5(2NPA)
PPARA_HUMAN
[Raw transfer]




Y1N_A_2(4CI4)
PPARA_HUMAN
[Raw transfer]




3EQ_A_3(3PEQ)
PPARD_HUMAN
[Raw transfer]




IL2_A_3(3SP9)
PPARD_HUMAN
[Raw transfer]




VCA_F_6(2BAW)
PPARD_HUMAN
[Raw transfer]




VCA_A_7(2B50)
PPARD_HUMAN
[Raw transfer]




5BC_A_3(3NOA)
PPARG_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




VCA_B_8(2B50)
PPARD_HUMAN
[Raw transfer]




3EQ_B_10(3PEQ)
PPARD_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




5BC_B_4(3NOA)
PPARG_HUMAN
[Raw transfer]




L41_B_4(3D5F)
PPARD_HUMAN
[Raw transfer]




735_C_3(2P54)
PPARA_HUMAN
[Raw transfer]




VCA_E_5(2AWH)
PPARD_HUMAN
[Raw transfer]




DRD_A_3(2HWR)
PPARG_HUMAN
[Raw transfer]




MMB_C_6(2NPA)
PPARA_HUMAN
[Raw transfer]




VCA_F_6(2AWH)
PPARD_HUMAN
[Raw transfer]




RO7_A_3(3G8I)
PPARA_HUMAN
[Raw transfer]




CTM_A_3(3FEJ)
PPARG_HUMAN
[Raw transfer]




208_A_3(2GTK)
PPARG_HUMAN
[Raw transfer]




L41_A_3(3D5F)
PPARD_HUMAN
[Raw transfer]




UNT_A_3(3IA6)
PPARG_HUMAN
[Raw transfer]




RO7_A_3(3G9E)
PPARG_HUMAN
[Raw transfer]




ET1_B_6(3ET1)
PPARA_HUMAN
[Raw transfer]




S44_A_3(2ZNO)
PPARG_HUMAN
[Raw transfer]




CTM_A_3(3FEI)
PPARA_HUMAN
[Raw transfer]




331_N_14(1Y0S)
PPARD_HUMAN
[Raw transfer]




4HD_A_3(2VV1)
PPARG_HUMAN
[Raw transfer]




24L_A_3(3V9Y)
PPARG_HUMAN
[Raw transfer]




331_O_15(1Y0S)
PPARD_HUMAN
[Raw transfer]




ET1_A_5(3ET1)
PPARA_HUMAN
[Raw transfer]




M7S_A_3(3AN3)
PPARG_HUMAN
[Raw transfer]




K55_A_4(2ZNP)
PPARD_HUMAN
[Raw transfer]




EK1_A_3(3VSO)
PPARG_HUMAN
[Raw transfer]




AZ2_C_3(1I7I)
PPARG_HUMAN
[Raw transfer]




3OZ_A_2(3OZ0)
PPARD_HUMAN
[Raw transfer]




Y1N_A_3(4CI5)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3B3K)
PPARG_HUMAN
[Raw transfer]




3EA_C_3(2ATH)
PPARG_HUMAN
[Raw transfer]




K55_B_6(2ZNP)
PPARD_HUMAN
[Raw transfer]




401_A_4(2ZNQ)
PPARD_HUMAN
[Raw transfer]




401_B_6(2ZNQ)
PPARD_HUMAN
[Raw transfer]




DRH_A_3(2I4Z)
PPARG_HUMAN
[Raw transfer]




EHA_C_3(2F4B)
PPARG_HUMAN
[Raw transfer]




DRJ_C_3(2I4J)
PPARG_HUMAN
[Raw transfer]




AZ2_D_4(1I7I)
PPARG_HUMAN
[Raw transfer]




GRR_A_3(3CDS)
PPARG_HUMAN
[Raw transfer]




L92_A_3(2Q8S)
PPARG_HUMAN
[Raw transfer]




XCX_A_3(3R8I)
PPARG_HUMAN
[Raw transfer]




UNT_B_4(3IA6)
PPARG_HUMAN
[Raw transfer]




3EA_D_4(2ATH)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET3)
PPARG_HUMAN
[Raw transfer]




ET1_B_7(3ET2)
PPARD_HUMAN
[Raw transfer]




C01_C_3(1ZEO)
PPARG_HUMAN
[Raw transfer]




GOL_B_4(2POB)
PPARG_HUMAN
[Raw transfer]




5OX_A_3(3X1H)
PPARG_HUMAN
[Raw transfer]




ZAA_A_2(3BC5)
PPARG_HUMAN
[Raw transfer]




DKD_A_3(3HO0)
PPARG_HUMAN
[Raw transfer]




ZZH_A_3(3HOD)
PPARG_HUMAN
[Raw transfer]




F22_A_3(2VV0)
PPARG_HUMAN
[Raw transfer]




DRH_C_3(2I4P)
PPARG_HUMAN
[Raw transfer]




538_D_6(3KMG)
PPARG_HUMAN
[Raw transfer]




J35_A_3(3VJH)
PPARG_HUMAN
[Raw transfer]




DRY_A_3(2HWQ)
PPARG_HUMAN
[Raw transfer]




M7R_A_3(3AN4)
PPARG_HUMAN
[Raw transfer]




GW4_A_3(2POB)
PPARG_HUMAN
[Raw transfer]




471_K_11(1KKQ)
PPARA_HUMAN
[Raw transfer]




TLS_A_3(3VN2)
PPARG_HUMAN
[Raw transfer]




5HE_A_3(2VV2)
PPARG_HUMAN
[Raw transfer]




471_L_12(1KKQ)
PPARA_HUMAN
[Raw transfer]




YRG_A_3(3CDP)
PPARG_HUMAN
[Raw transfer]




S44_B_4(2ZNO)
PPARG_HUMAN
[Raw transfer]




538_A_5(3KMG)
PPARG_HUMAN
[Raw transfer]




OCX_A_3(2ZK3)
PPARG_HUMAN
[Raw transfer]




LRG_A_2(4L96)
PPARG_HUMAN
[Raw transfer]




RRG_A_4(4E4K)
PPARG_HUMAN
[Raw transfer]




240_B_4(2Q59)
PPARG_HUMAN
[Raw transfer]




1FA_A_3(2Q5G)
PPARD_HUMAN
[Raw transfer]




3JX_D_4(4R2U)
PPARG_HUMAN
[Raw transfer]




4R8_A_3(2VV3)
PPARG_HUMAN
[Raw transfer]




WLM_A_3(2XYJ)
PPARD_HUMAN
[Raw transfer]




GW0_A_2(3TKM)
PPARD_HUMAN
[Raw transfer]




EK8_A_3(3VSP)
PPARG_HUMAN
[Raw transfer]




3K2_B_4(4R6S)
PPARG_HUMAN
[Raw transfer]




AJA_B_7(2OM9)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADS)
PPARG_HUMAN
[Raw transfer]




WLM_B_6(2XYJ)
PPARD_HUMAN
[Raw transfer]




LRG_B_4(4L98)
PPARG_HUMAN
[Raw transfer]




14R_X_3(4HEE)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET2)
PPARD_HUMAN
[Raw transfer]




471_I_9(1KKQ)
PPARA_HUMAN
[Raw transfer]




LRG_A_3(4L98)
PPARG_HUMAN
[Raw transfer]




3JX_A_3(4R2U)
PPARG_HUMAN
[Raw transfer]




LNA_A_5(3CWD)
PPARG_HUMAN
[Raw transfer]




NSI_D_4(2HFP)
PPARG_HUMAN
[Raw transfer]




MYI_A_4(3ADU)
PPARG_HUMAN
[Raw transfer]




AJA_D_12(2OM9)
PPARG_HUMAN
[Raw transfer]




LNA_B_7(3CWD)
PPARG_HUMAN
[Raw transfer]




17L_A_3(3V9T)
PPARG_HUMAN
[Raw transfer]




3K2_A_3(4R6S)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZVT)
PPARG_HUMAN
[Raw transfer]




M0T_A_3(3S9S)
PPARG_HUMAN
[Raw transfer]




HID_A_3(3ADT)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADX)
PPARG_HUMAN
[Raw transfer]




6OC_A_3(2VV4)
PPARG_HUMAN
[Raw transfer]




66B_A_3(3X1I)
PPARG_HUMAN
[Raw transfer]




AJA_C_9(2OM9)
PPARG_HUMAN
[Raw transfer]




AJA_A_5(2OM9)
PPARG_HUMAN
[Raw transfer]




471_J_10(1KKQ)
PPARA_HUMAN
[Raw transfer]




D30_D_6(3H0A)
PPARG_HUMAN
[Raw transfer]




486_A_3(3QT0)
PPARG_HUMAN
[Raw transfer]




OCR_A_3(2ZK4)
PPARG_HUMAN
[Raw transfer]




Z00_A_3(2XYX)
PPARD_HUMAN
[Raw transfer]




GW9_B_4(3B0R)
PPARG_HUMAN
[Raw transfer]




08S_A_3(2XYW)
PPARD_HUMAN
[Raw transfer]




HIG_A_3(3R8A)
PPARG_HUMAN
[Raw transfer]




AXY_A_3(4JL4)
PPARG_HUMAN
[Raw transfer]




DY6_B_5(3DY6)
PPARD_HUMAN
[Raw transfer]




Z00_B_5(2XYX)
PPARD_HUMAN
[Raw transfer]




HIG_B_4(3R8A)
PPARG_HUMAN
[Raw transfer]




DY6_A_4(3DY6)
PPARD_HUMAN
[Raw transfer]




JJA_B_4(3WMH)
PPARG_HUMAN
[Raw transfer]




ZXG_A_3(3PBA)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3D6D)
PPARG_HUMAN
[Raw transfer]




08S_B_5(2XYW)
PPARD_HUMAN
[Raw transfer]




SF2_A_3(2Q6R)
PPARG_HUMAN
[Raw transfer]




243_B_4(2VST)
PPARG_HUMAN
[Raw transfer]




SF2_B_4(2Q6R)
PPARG_HUMAN
[Raw transfer]




MLO_A_3(3R5N)
PPARG_HUMAN
[Raw transfer]




T9T_B_4(3WJ5)
PPARG_HUMAN
[Raw transfer]




SF1_B_3(2Q61)
PPARG_HUMAN
[Raw transfer]




21L_A_3(3V9V)
PPARG_HUMAN
[Raw transfer]




JJA_A_3(3WMH)
PPARG_HUMAN
[Raw transfer]




SF1_A_4(2Q61)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZK1)
PPARG_HUMAN
[Raw transfer]




EPA_B_4(3GWX)
PPARD_HUMAN
[Raw transfer]




1FA_B_4(2Q5G)
PPARD_HUMAN
[Raw transfer]




YFD_A_3(4A4V)
PPARG_HUMAN
[Raw transfer]




YFE_A_3(2YFE)
PPARG_HUMAN
[Raw transfer]




NZA_B_3(2Q5S)
PPARG_HUMAN
[Raw transfer]




Z27_A_3(3K8S)
PPARG_HUMAN
[Raw transfer]




241_A_3(2Q5P)
PPARG_HUMAN
[Raw transfer]




T9T_A_3(3WJ5)
PPARG_HUMAN
[Raw transfer]




243_A_3(2VST)
PPARG_HUMAN
[Raw transfer]




TBY_B_4(3WJ4)
PPARG_HUMAN
[Raw transfer]




5OX_B_4(3X1H)
PPARG_HUMAN
[Raw transfer]




4HD_B_4(2VV1)
PPARG_HUMAN
[Raw transfer]




WY1_A_5(4BCR)
PPARA_HUMAN
[Raw transfer]




TBY_A_3(3WJ4)
PPARG_HUMAN
[Raw transfer]




XPT_B_4(3PO9)
PPARG_HUMAN
[Raw transfer]




NZA_A_4(2Q5S)
PPARG_HUMAN
[Raw transfer]




6OB_B_4(2VV4)
PPARG_HUMAN
[Raw transfer]




C08_A_3(2ZK6)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZVT)
PPARG_HUMAN
[Raw transfer]




YFE_B_4(2YFE)
PPARG_HUMAN
[Raw transfer]




XPT_A_3(3PO9)
PPARG_HUMAN
[Raw transfer]




SP0_C_3(2G0G)
PPARG_HUMAN
[Raw transfer]




C08_B_4(2ZK6)
PPARG_HUMAN
[Raw transfer]




NRO_B_4(2ZK5)
PPARG_HUMAN
[Raw transfer]




NRO_A_3(2ZK5)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADS)
PPARG_HUMAN
[Raw transfer]




RRH_A_3(4E4Q)
PPARG_HUMAN
[Raw transfer]




RO0_C_3(2FVJ)
PPARG_HUMAN
[Raw transfer]




WY1_B_8(4BCR)
PPARA_HUMAN
[Raw transfer]




CEK_A_3(3LMP)
PPARG_HUMAN
[Raw transfer]




Z12_A_3(3FUR)
PPARG_HUMAN
[Raw transfer]




PLB_D_12(3DZU)
PPARG_HUMAN
[Raw transfer]




FCM_A_3(4F9M)
PPARG_HUMAN
[Raw transfer]




YFB_B_4(4A4W)
PPARG_HUMAN
[Raw transfer]




OCR_B_4(2ZK4)
PPARG_HUMAN
[Raw transfer]




LU2_B_5(3SZ1)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADX)
PPARG_HUMAN
[Raw transfer]




SP3_C_3(2G0H)
PPARG_HUMAN
[Raw transfer]




PTG_A_4(2ZK2)
PPARG_HUMAN
[Raw transfer]




DIF_A_2(4OJ4)
PPARG_HUMAN
[Raw transfer]




KRC_A_3(3B1M)
PPARG_HUMAN
[Raw transfer]




YFD_B_4(4A4V)
PPARG_HUMAN
[Raw transfer]




SP3_D_4(2G0H)
PPARG_HUMAN
[Raw transfer]




OCX_B_4(2ZK3)
PPARG_HUMAN
[Raw transfer]




XDI_A_3(3OSW)
PPARG_HUMAN
[Raw transfer]




66B_B_4(3X1I)
PPARG_HUMAN
[Raw transfer]




F22_B_4(2VV0)
PPARG_HUMAN
[Raw transfer]




9HO_B_5(2VSR)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZK1)
PPARG_HUMAN
[Raw transfer]




GW9_D_12(3E00)
PPARG_HUMAN
[Raw transfer]




Z27_B_5(3K8S)
PPARG_HUMAN
[Raw transfer]




XDH_A_3(3OSI)
PPARG_HUMAN
[Raw transfer]




MYI_B_7(3ADU)
PPARG_HUMAN
[Raw transfer]




9HO_A_4(2VSR)
PPARG_HUMAN
[Raw transfer]




MYI_A_3(3ADW)
PPARG_HUMAN
[Raw transfer]




OCR_B_5(3ADW)
PPARG_HUMAN
[Raw transfer]




MSZ_A_3(4PWL)
PPARG_HUMAN
[Raw transfer]




SRO_A_3(3ADV)
PPARG_HUMAN
[Raw transfer]




5HE_B_5(2VV2)
PPARG_HUMAN
[Raw transfer]




KNA_A_4(3SZ1)
PPARG_HUMAN
[Raw transfer]




SRO_B_5(3ADV)
PPARG_HUMAN
[Raw transfer]




28 PsiBlast_CBE 91.4399%-148 - C3 -2NPA 9.4 PPARA_HUMAN
13 PsiBlast_PDB 91.22100%-146 - C3 -2P54 9.4 PPARA_HUMAN
27 PsiBlast_CBE 91.09100%-141 - C3 -3ET1 6.1 PPARA_HUMAN
3 PsiBlast_PDB 90.92100%-153 - C3 -4CI4 8.5 PPARA_HUMAN
8 PsiBlast_PDB 90.63100%-143 - C3 -3ET1 7.0 PPARA_HUMAN
6 PsiBlast_PDB 90.56100%-141 - C3 -3SP6 8.0 PPARA_HUMAN
11 PsiBlast_PDB 89.6999%-139 - C3 -2NPA 9.2 PPARA_HUMAN
14 PsiBlast_PDB 89.39100%-149 - C3 -3FEI 7.5 PPARA_HUMAN
24 PsiBlast_CBE 89.37100%-146 - C3 -4BCR 5.2 PPARA_HUMAN
16 PsiBlast_PDB 89.1762%-126 - C3 -3E00 4.2 PPARG_HUMAN
7 PsiBlast_PDB 88.89100%-151 - C3 -3G8I 9.5 PPARA_HUMAN
2 PsiBlast_PDB 88.70100%-145 - C3 -4BCR 5.6 PPARA_HUMAN
9 PsiBlast_PDB 88.50100%-143 - C3 -2ZNN 11.2 PPARA_HUMAN
10 PsiBlast_PDB 88.22100%-142 - C3 -3VI8 11.2 PPARA_HUMAN
239 HHSearch 88.0299%-142 - C3 -3VI8 11.2 PPARA_HUMAN
15 PsiBlast_PDB 87.4262%-131 - C3 -3DZU 5.5 PPARG_HUMAN
29 PsiBlast_CBE 85.52100%-136 - C3 -1KKQ 11.3 PPARA_HUMAN
31 PsiBlast_CBE 85.31100%-143 - C3 -1KKQ 10.8 PPARA_HUMAN
30 PsiBlast_CBE 85.25100%-140 - C3 -1KKQ 10.8 PPARA_HUMAN
12 PsiBlast_PDB 84.62100%-138 - C3 -1KKQ 10.7 PPARA_HUMAN
49 PsiBlast_CBE 83.9170%-144 - C3 -3TKM 6.2 PPARD_HUMAN
38 PsiBlast_CBE 83.2370%-148 - C3 -3PEQ 9.3 PPARD_HUMAN
51 PsiBlast_CBE 82.8870%-142 - C3 -1Y0S 8.1 PPARD_HUMAN
55 PsiBlast_CBE 82.6270%-142 - C3 -2ZNP 7.4 PPARD_HUMAN
43 PsiBlast_CBE 82.5870%-148 - C3 -3DY6 6.9 PPARD_HUMAN
57 PsiBlast_CBE 82.5770%-143 - C3 -3SP9 6.2 PPARD_HUMAN
52 PsiBlast_CBE 82.5670%-142 - C3 -2ZNQ 7.8 PPARD_HUMAN
60 PsiBlast_CBE 82.5270%-149 - C3 -2AWH 5.1 PPARD_HUMAN
56 PsiBlast_CBE 82.4770%-143 - C3 -3SP9 5.9 PPARD_HUMAN
42 PsiBlast_CBE 82.4070%-147 - C3 -3DY6 6.9 PPARD_HUMAN
34 PsiBlast_CBE 82.3469%-143 - C3 -2XYJ 7.2 PPARD_HUMAN
64 PsiBlast_CBE 82.2770%-143 - C3 -3D5F 7.1 PPARD_HUMAN
58 PsiBlast_CBE 82.2469%-141 - C3 -2B50 5.2 PPARD_HUMAN
65 PsiBlast_CBE 82.2270%-148 - C3 -2BAW 6.3 PPARD_HUMAN
18 PsiBlast_PDB 82.2269%-145 - C3 -2XYW 9.1 PPARD_HUMAN
36 PsiBlast_CBE 82.2169%-142 - C3 -3ET2 5.9 PPARD_HUMAN
53 PsiBlast_CBE 82.0470%-140 - C3 -2ZNQ 8.8 PPARD_HUMAN
46 PsiBlast_CBE 82.0469%-144 - C3 -3OZ0 7.7 PPARD_HUMAN
50 PsiBlast_CBE 82.0170%-143 - C3 -1Y0S 6.9 PPARD_HUMAN
63 PsiBlast_CBE 81.9770%-143 - C3 -3D5F 7.2 PPARD_HUMAN
39 PsiBlast_CBE 81.9470%-147 - C3 -3PEQ 7.5 PPARD_HUMAN
59 PsiBlast_CBE 81.9369%-142 - C3 -2B50 5.5 PPARD_HUMAN
37 PsiBlast_CBE 81.8569%-144 - C3 -3ET2 6.6 PPARD_HUMAN
19 PsiBlast_PDB 81.8469%-144 - C3 -2XYX 7.3 PPARD_HUMAN
61 PsiBlast_CBE 81.6670%-145 - C3 -2AWH 5.8 PPARD_HUMAN
17 PsiBlast_PDB 81.6069%-135 - C3 -2XYJ 5.6 PPARD_HUMAN
33 PsiBlast_CBE 81.4969%-144 - C3 -2XYW 8.9 PPARD_HUMAN
32 PsiBlast_CBE 81.4769%-141 - C3 -2XYX 7.2 PPARD_HUMAN
122 PsiBlast_CBE 81.4261%-140 - C3 -3ET3 5.9 PPARG_HUMAN
149 PsiBlast_CBE 81.0361%-139 - C3 -2GTK 7.4 PPARG_HUMAN
54 PsiBlast_CBE 80.9970%-138 - C3 -2ZNP 7.6 PPARD_HUMAN
124 PsiBlast_CBE 80.9061%-135 - C3 -4CI5 7.0 PPARG_HUMAN
40 PsiBlast_CBE 80.8970%-131 - C3 -3GWX 5.4 PPARD_HUMAN
132 PsiBlast_CBE 80.7161%-142 - C3 -2POB 8.7 PPARG_HUMAN
110 PsiBlast_CBE 80.7161%-135 - C3 -3LMP 6.1 PPARG_HUMAN
100 PsiBlast_CBE 80.6561%-139 - C3 -4HEE 9.9 PPARG_HUMAN