@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR1I2_PXR: (2016-04-07 )
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_3(4NY9)
NR1I2_HUMAN
[Raw transfer]




RFP_B_2(1SKX)
NR1I2_HUMAN
[Raw transfer]




SRL_A_5(1NRL)
NR1I2_HUMAN
[Raw transfer]




40U_B_6(4S0T)
NR1I2_HUMAN
[Raw transfer]




444_E_5(2O9I)
NR1I2_HUMAN
[Raw transfer]




4 PsiBlast_PDB 98.87100%-136 - C4 -4X1F - ? -
6 PsiBlast_PDB 95.94100%-143 - C4 -4NY9 2.1 NR1I2_HUMAN
22 PsiBlast_CBE 95.8199%-131 - C4 -2O9I 7.5 NR1I2_HUMAN
5 PsiBlast_PDB 95.7899%-133 - C4 -2O9I - NR1I2_HUMAN -
211 Fugue 95.5399%-142 - C4 -1SKX 9.3 NR1I2_HUMAN
21 PsiBlast_CBE 94.84100%-138 - C4 -4S0T 8.5 NR1I2_HUMAN
2 PsiBlast_PDB 94.82100%-145 - C4 -2QNV - NR1I2_HUMAN -
1 PsiBlast_PDB 94.18100%-139 - C4 -4S0T - NR1I2_HUMAN -
3 PsiBlast_PDB 92.71100%-135 - C4 -3R8D - NR1I2_HUMAN -
188 HHSearch 82.09100%-149 - C4 -1NRL 7.1 NR1I2_HUMAN
10 PsiBlast_PDB 77.9237%-123 - C4 -3DR1 - VDRA_DANRE -
7 PsiBlast_PDB 77.2937%-122 - C4 -2HBH - VDRA_DANRE -
18 PsiBlast_PDB 77.1837%-124 - C4 -4G1Z - VDRA_DANRE -
14 PsiBlast_PDB 77.1737%-126 - C4 -4FHH - VDRA_DANRE -
26 PsiBlast_CBE 77.1237%-123 - C4 -4IA1 - VDRA_DANRE -
23 PsiBlast_CBE 76.8437%-123 - C4 -4IA7 - VDRA_DANRE -
13 PsiBlast_PDB 76.7737%-126 - C4 -4Q0A - VDRA_DANRE -
17 PsiBlast_PDB 76.7137%-126 - C4 -4G1Y - VDRA_DANRE -
24 PsiBlast_CBE 76.7037%-123 - C4 -4IA3 - VDRA_DANRE -
27 PsiBlast_CBE 76.6537%-124 - C4 -4G2H - VDRA_DANRE -