@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR1B3_RARg: (2016-11-24 )
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

394_A_2(1EXA)
RARG_HUMAN
[Raw transfer]




184_A_2(1FCX)
RARG_HUMAN
[Raw transfer]




1NY_A_5(4JYG)
RARB_HUMAN
[Raw transfer]




JYH_B_6(4JYH)
RARB_HUMAN
[Raw transfer]




1NY_B_7(4JYG)
RARB_HUMAN
[Raw transfer]




REA_B_5(3A9E)
RARA_HUMAN
[Raw transfer]




564_A_2(1FCY)
RARG_HUMAN
[Raw transfer]




254_A_2(1FD0)
RARG_HUMAN
[Raw transfer]




JYH_A_5(4JYH)
RARB_HUMAN
[Raw transfer]




TTB_A_5(4DM6)
RARB_HUMAN
[Raw transfer]




564_A_2(1FCY)
RARG_HUMAN
[Raw transfer]




REA_B_2(3LBD)
RARG_HUMAN
[Raw transfer]




TTB_B_6(4DM6)
RARB_HUMAN
[Raw transfer]




156_A_2(1FCZ)
RARG_HUMAN
[Raw transfer]




961_B_2(4LBD)
RARG_HUMAN
[Raw transfer]




EQN_A_3(3KMR)
RARA_HUMAN
[Raw transfer]




REA_J_10(1XDK)
RARB_MOUSE
[Raw transfer]




REA_J_10(1XDK)
RARB_MOUSE
[Raw transfer]




961_A_2(1EXX)
RARG_HUMAN
[Raw transfer]




REA_L_12(1XDK)
RARB_MOUSE
[Raw transfer]




EQN_A_3(3KMR)
RARA_HUMAN
[Raw transfer]




JYI_B_6(4JYI)
RARB_HUMAN
[Raw transfer]




REA_B_6(4DM8)
RARB_HUMAN
[Raw transfer]




JYI_A_5(4JYI)
RARB_HUMAN
[Raw transfer]




TTB_B_2(1XAP)
RARB_HUMAN
[Raw transfer]




EQO_A_10(3KMZ)
RARA_HUMAN
[Raw transfer]




EQO_B_5(3KMZ)
RARA_HUMAN
[Raw transfer]




BMS_C_3(1DKF)
RARA_HUMAN
[Raw transfer]




REA_A_5(4DM8)
RARB_HUMAN
[Raw transfer]




LUF_C_6(4DQM)
RARA_HUMAN
[Raw transfer]




6Q7_A_2(5K13)
RARA_HUMAN
[Raw transfer]




LUF_A_5(4DQM)
RARA_HUMAN
[Raw transfer]




56 HHSearch 88.52100%-141 - C4 -1FCY 11.2 RARG_HUMAN
6 PsiBlast_PDB 88.11100%-138 - C4 -1FCY 11.2 RARG_HUMAN
7 PsiBlast_PDB 88.04100%-137 - C4 -1FCX 11.4 RARG_HUMAN
8 PsiBlast_PDB 88.02100%-137 - C4 -1FCZ 10.6 RARG_HUMAN
9 PsiBlast_PDB 87.94100%-137 - C4 -1FD0 11.0 RARG_HUMAN
3 PsiBlast_PDB 87.93100%-131 - C4 -4LBD 10.6 RARG_HUMAN
4 PsiBlast_PDB 87.89100%-133 - C4 -1EXA 10.3 RARG_HUMAN
2 PsiBlast_PDB 87.10100%-125 - C4 -3LBD 8.8 RARG_HUMAN
5 PsiBlast_PDB 86.99100%-133 - C4 -1EXX 10.0 RARG_HUMAN
23 PsiBlast_CBE 83.5386%-134 - C4 -4DM6 10.2 RARB_HUMAN
25 PsiBlast_CBE 83.4485%-138 - C4 -4JYH 9.8 RARB_HUMAN
16 PsiBlast_PDB 83.4285%-137 - C4 -4JYI 11.1 RARB_HUMAN
12 PsiBlast_PDB 83.3086%-131 - C4 -4DM6 10.1 RARB_HUMAN
24 PsiBlast_CBE 83.2685%-134 - C4 -4JYI 11.4 RARB_HUMAN
17 PsiBlast_PDB 83.1181%-132 - C4 -3A9E 8.0 RARA_HUMAN
22 PsiBlast_CBE 83.1086%-130 - C4 -4DM8 8.5 RARB_HUMAN
15 PsiBlast_PDB 82.9985%-141 - C4 -4JYH 9.7 RARB_HUMAN
26 PsiBlast_CBE 82.8485%-129 - C4 -4JYG 10.4 RARB_HUMAN
14 PsiBlast_PDB 82.6785%-142 - C4 -4JYG 10.3 RARB_HUMAN
53 HHSearch 82.0083%-131 - C4 -3KMR 9.7 RARA_HUMAN
28 PsiBlast_CBE 81.9383%-142 - C4 -1DKF 10.4 RARA_HUMAN
18 PsiBlast_PDB 81.7982%-131 - C4 -3KMR 9.7 RARA_HUMAN
30 PsiBlast_CBE 81.3183%-132 - C4 -4DQM 4.2 RARA_HUMAN
10 PsiBlast_PDB 81.1084%-123 - C4 -1XDK 8.6 RARB_MOUSE
21 PsiBlast_CBE 81.0484%-124 - C4 -1XDK 8.6 RARB_MOUSE
13 PsiBlast_PDB 81.0386%-132 - C4 -4DM8 8.4 RARB_HUMAN
50 HHSearch 80.8284%-123 - C4 -1XDK 8.6 RARB_MOUSE
20 PsiBlast_PDB 80.3981%-134 - C4 -5K13 11.3 RARA_HUMAN
11 PsiBlast_PDB 80.1486%-132 - C4 -1XAP 10.3 RARB_HUMAN
27 PsiBlast_CBE 77.5182%-127 - C4 -3KMZ 11.2 RARA_HUMAN
19 PsiBlast_PDB 77.4182%-128 - C4 -3KMZ 11.4 RARA_HUMAN
29 PsiBlast_CBE 74.7483%-137 - C4 -4DQM 6.1 RARA_HUMAN