@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR1C1_PPARa: (2016-11-24 )
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Atome Classification :

(221 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

S44_A_2(2ZNN)
PPARA_HUMAN
[Raw transfer]




NKS_A_3(3KDU)
PPARA_HUMAN
[Raw transfer]




Y1N_A_2(4CI4)
PPARA_HUMAN
[Raw transfer]




2PQ_A_3(3GBK)
PPARG_HUMAN
[Raw transfer]




IL2_A_3(3SP6)
PPARA_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




NKS_B_4(3KDU)
PPARA_HUMAN
[Raw transfer]




IL2_A_3(3SP9)
PPARD_HUMAN
[Raw transfer]




MMB_A_5(2NPA)
PPARA_HUMAN
[Raw transfer]




IL2_B_4(3SP9)
PPARD_HUMAN
[Raw transfer]




735_C_3(2P54)
PPARA_HUMAN
[Raw transfer]




RO7_A_3(3G8I)
PPARA_HUMAN
[Raw transfer]




MMB_C_6(2NPA)
PPARA_HUMAN
[Raw transfer]




3EQ_A_3(3PEQ)
PPARD_HUMAN
[Raw transfer]




5BC_A_3(3NOA)
PPARG_HUMAN
[Raw transfer]




3EQ_B_10(3PEQ)
PPARD_HUMAN
[Raw transfer]




7HA_B_4(3KDT)
PPARA_HUMAN
[Raw transfer]




S44_A_3(2ZNO)
PPARG_HUMAN
[Raw transfer]




DRD_A_3(2HWR)
PPARG_HUMAN
[Raw transfer]




7HA_A_3(3KDT)
PPARA_HUMAN
[Raw transfer]




VCA_B_8(2B50)
PPARD_HUMAN
[Raw transfer]




VCA_F_6(2BAW)
PPARD_HUMAN
[Raw transfer]




5BC_B_4(3NOA)
PPARG_HUMAN
[Raw transfer]




UNT_A_3(3IA6)
PPARG_HUMAN
[Raw transfer]




VCA_A_7(2B50)
PPARD_HUMAN
[Raw transfer]




RO7_A_3(3G9E)
PPARG_HUMAN
[Raw transfer]




VCA_E_5(2AWH)
PPARD_HUMAN
[Raw transfer]




4HD_A_3(2VV1)
PPARG_HUMAN
[Raw transfer]




CTM_A_3(3FEI)
PPARA_HUMAN
[Raw transfer]




T53_A_3(5DVC)
?
[Raw transfer]




4M5_A_4(5AZT)
PPARA_HUMAN
[Raw transfer]




24L_A_3(3V9Y)
PPARG_HUMAN
[Raw transfer]




331_O_15(1Y0S)
PPARD_HUMAN
[Raw transfer]




L41_B_4(3D5F)
PPARD_HUMAN
[Raw transfer]




M7S_A_3(3AN3)
PPARG_HUMAN
[Raw transfer]




208_A_3(2GTK)
PPARG_HUMAN
[Raw transfer]




L41_A_3(3D5F)
PPARD_HUMAN
[Raw transfer]




VCA_F_6(2AWH)
PPARD_HUMAN
[Raw transfer]




331_N_14(1Y0S)
PPARD_HUMAN
[Raw transfer]




ET1_B_6(3ET1)
PPARA_HUMAN
[Raw transfer]




CTM_A_3(3FEJ)
PPARG_HUMAN
[Raw transfer]




EHA_C_3(2F4B)
PPARG_HUMAN
[Raw transfer]




EK1_A_3(3VSO)
PPARG_HUMAN
[Raw transfer]




UNT_B_4(3IA6)
PPARG_HUMAN
[Raw transfer]




AZ2_C_3(1I7I)
PPARG_HUMAN
[Raw transfer]




T51_A_3(5DV8)
PPARG_HUMAN
[Raw transfer]




L92_A_3(2Q8S)
PPARG_HUMAN
[Raw transfer]




Y1N_A_3(4CI5)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3B3K)
PPARG_HUMAN
[Raw transfer]




XCX_A_3(3R8I)
PPARG_HUMAN
[Raw transfer]




GOL_B_4(2POB)
PPARG_HUMAN
[Raw transfer]




ET1_A_5(3ET1)
PPARA_HUMAN
[Raw transfer]




GNI_B_4(2J14)
PPARD_HUMAN
[Raw transfer]




DRJ_C_3(2I4J)
PPARG_HUMAN
[Raw transfer]




B05_A_3(5DV3)
PPARG_HUMAN
[Raw transfer]




DRH_A_3(2I4Z)
PPARG_HUMAN
[Raw transfer]




5OX_A_3(3X1H)
PPARG_HUMAN
[Raw transfer]




M7R_A_3(3AN4)
PPARG_HUMAN
[Raw transfer]




3EA_C_3(2ATH)
PPARG_HUMAN
[Raw transfer]




4M5_B_5(5AZT)
PPARA_HUMAN
[Raw transfer]




ZAA_A_2(3BC5)
PPARG_HUMAN
[Raw transfer]




471_L_12(1KKQ)
PPARA_HUMAN
[Raw transfer]




F22_A_3(2VV0)
PPARG_HUMAN
[Raw transfer]




GNI_A_3(2J14)
PPARD_HUMAN
[Raw transfer]




538_D_6(3KMG)
PPARG_HUMAN
[Raw transfer]




471_K_11(1KKQ)
PPARA_HUMAN
[Raw transfer]




GRR_A_3(3CDS)
PPARG_HUMAN
[Raw transfer]




S44_B_4(2ZNO)
PPARG_HUMAN
[Raw transfer]




AZ2_D_4(1I7I)
PPARG_HUMAN
[Raw transfer]




3EA_D_4(2ATH)
PPARG_HUMAN
[Raw transfer]




C01_C_3(1ZEO)
PPARG_HUMAN
[Raw transfer]




401_B_6(2ZNQ)
PPARD_HUMAN
[Raw transfer]




5HE_A_3(2VV2)
PPARG_HUMAN
[Raw transfer]




DRY_A_3(2HWQ)
PPARG_HUMAN
[Raw transfer]




3JX_D_4(4R2U)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET3)
PPARG_HUMAN
[Raw transfer]




J35_A_3(3VJH)
PPARG_HUMAN
[Raw transfer]




401_A_4(2ZNQ)
PPARD_HUMAN
[Raw transfer]




4R8_A_3(2VV3)
PPARG_HUMAN
[Raw transfer]




ET1_B_7(3ET2)
PPARD_HUMAN
[Raw transfer]




YRG_A_3(3CDP)
PPARG_HUMAN
[Raw transfer]




WLM_A_3(2XYJ)
PPARD_HUMAN
[Raw transfer]




K55_A_4(2ZNP)
PPARD_HUMAN
[Raw transfer]




3K2_B_4(4R6S)
PPARG_HUMAN
[Raw transfer]




3JX_A_3(4R2U)
PPARG_HUMAN
[Raw transfer]




TLS_A_3(3VN2)
PPARG_HUMAN
[Raw transfer]




ZZH_A_3(3HOD)
PPARG_HUMAN
[Raw transfer]




538_A_5(3KMG)
PPARG_HUMAN
[Raw transfer]




14R_X_3(4HEE)
PPARG_HUMAN
[Raw transfer]




K55_B_6(2ZNP)
PPARD_HUMAN
[Raw transfer]




DRH_C_3(2I4P)
PPARG_HUMAN
[Raw transfer]




EK8_A_3(3VSP)
PPARG_HUMAN
[Raw transfer]




LNA_A_5(3CWD)
PPARG_HUMAN
[Raw transfer]




GW4_A_3(2POB)
PPARG_HUMAN
[Raw transfer]




3OZ_A_2(3OZ0)
PPARD_HUMAN
[Raw transfer]




471_I_9(1KKQ)
PPARA_HUMAN
[Raw transfer]




DKD_A_3(3HO0)
PPARG_HUMAN
[Raw transfer]




OCX_A_3(2ZK3)
PPARG_HUMAN
[Raw transfer]




66B_A_3(3X1I)
PPARG_HUMAN
[Raw transfer]




SFI_A_4(4XUH)
PPARG_HUMAN
[Raw transfer]




LRG_A_2(4L96)
PPARG_HUMAN
[Raw transfer]




EPA_A_3(3GWX)
PPARD_HUMAN
[Raw transfer]




AJA_B_7(2OM9)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET2)
PPARD_HUMAN
[Raw transfer]




6OC_A_3(2VV4)
PPARG_HUMAN
[Raw transfer]




WLM_B_6(2XYJ)
PPARD_HUMAN
[Raw transfer]




4M5_A_3(5AZV)
PPARG_HUMAN
[Raw transfer]




OCR_A_3(2ZK4)
PPARG_HUMAN
[Raw transfer]




3K2_A_3(4R6S)
PPARG_HUMAN
[Raw transfer]




RRG_A_4(4E4K)
PPARG_HUMAN
[Raw transfer]




17L_A_3(3V9T)
PPARG_HUMAN
[Raw transfer]




471_J_10(1KKQ)
PPARA_HUMAN
[Raw transfer]




IMN_A_4(3ADS)
PPARG_HUMAN
[Raw transfer]




LRG_B_4(4L98)
PPARG_HUMAN
[Raw transfer]




LNA_B_7(3CWD)
PPARG_HUMAN
[Raw transfer]




GW0_A_2(3TKM)
PPARD_HUMAN
[Raw transfer]




240_B_4(2Q59)
PPARG_HUMAN
[Raw transfer]




5VN_B_3(5F9B)
PPARG_HUMAN
[Raw transfer]




MYI_A_4(3ADU)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(4L98)
PPARG_HUMAN
[Raw transfer]




1FA_A_3(2Q5G)
PPARD_HUMAN
[Raw transfer]




IMN_A_4(3ADX)
PPARG_HUMAN
[Raw transfer]




NSI_D_4(2HFP)
PPARG_HUMAN
[Raw transfer]




HID_A_3(3ADT)
PPARG_HUMAN
[Raw transfer]




HIG_A_3(3R8A)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZVT)
PPARG_HUMAN
[Raw transfer]




AJA_A_5(2OM9)
PPARG_HUMAN
[Raw transfer]




AJA_D_12(2OM9)
PPARG_HUMAN
[Raw transfer]




AXY_A_3(4JL4)
PPARG_HUMAN
[Raw transfer]




D30_D_6(3H0A)
PPARG_HUMAN
[Raw transfer]




DY6_A_4(3DY6)
PPARD_HUMAN
[Raw transfer]




JJA_B_4(3WMH)
PPARG_HUMAN
[Raw transfer]




Z00_A_3(2XYX)
PPARD_HUMAN
[Raw transfer]




08S_A_3(2XYW)
PPARD_HUMAN
[Raw transfer]




AJA_C_9(2OM9)
PPARG_HUMAN
[Raw transfer]




SF2_A_3(2Q6R)
PPARG_HUMAN
[Raw transfer]




DY6_B_5(3DY6)
PPARD_HUMAN
[Raw transfer]




M0T_A_3(3S9S)
PPARG_HUMAN
[Raw transfer]




486_A_3(3QT0)
PPARG_HUMAN
[Raw transfer]




ZXG_A_3(3PBA)
PPARG_HUMAN
[Raw transfer]




SF1_A_4(2Q61)
PPARG_HUMAN
[Raw transfer]




SFI_B_6(4XUH)
PPARG_HUMAN
[Raw transfer]




Z00_B_5(2XYX)
PPARD_HUMAN
[Raw transfer]




GW9_B_4(3B0R)
PPARG_HUMAN
[Raw transfer]




HIG_B_4(3R8A)
PPARG_HUMAN
[Raw transfer]




JJA_A_3(3WMH)
PPARG_HUMAN
[Raw transfer]




WY1_A_5(4BCR)
PPARA_HUMAN
[Raw transfer]




LRG_A_3(3D6D)
PPARG_HUMAN
[Raw transfer]




YFE_A_3(2YFE)
PPARG_HUMAN
[Raw transfer]




B4H_A_3(5DV6)
PPARG_HUMAN
[Raw transfer]




21L_A_3(3V9V)
PPARG_HUMAN
[Raw transfer]




4M5_B_4(5AZV)
PPARG_HUMAN
[Raw transfer]




SF2_B_4(2Q6R)
PPARG_HUMAN
[Raw transfer]




5OX_B_4(3X1H)
PPARG_HUMAN
[Raw transfer]




T9T_B_4(3WJ5)
PPARG_HUMAN
[Raw transfer]




243_B_4(2VST)
PPARG_HUMAN
[Raw transfer]




4HD_B_4(2VV1)
PPARG_HUMAN
[Raw transfer]




SF1_B_3(2Q61)
PPARG_HUMAN
[Raw transfer]




6BH_A_3(5DSH)
PPARG_HUMAN
[Raw transfer]




YFD_A_3(4A4V)
PPARG_HUMAN
[Raw transfer]




08S_B_5(2XYW)
PPARD_HUMAN
[Raw transfer]




6OB_B_4(2VV4)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZK1)
PPARG_HUMAN
[Raw transfer]




EPA_B_4(3GWX)
PPARD_HUMAN
[Raw transfer]




WY1_B_8(4BCR)
PPARA_HUMAN
[Raw transfer]




Z27_A_3(3K8S)
PPARG_HUMAN
[Raw transfer]




1FA_B_4(2Q5G)
PPARD_HUMAN
[Raw transfer]




TBY_A_3(3WJ4)
PPARG_HUMAN
[Raw transfer]




241_A_3(2Q5P)
PPARG_HUMAN
[Raw transfer]




NZA_A_4(2Q5S)
PPARG_HUMAN
[Raw transfer]




243_A_3(2VST)
PPARG_HUMAN
[Raw transfer]




T9T_A_3(3WJ5)
PPARG_HUMAN
[Raw transfer]




NZA_B_3(2Q5S)
PPARG_HUMAN
[Raw transfer]




RO0_C_3(2FVJ)
PPARG_HUMAN
[Raw transfer]




YFE_B_4(2YFE)
PPARG_HUMAN
[Raw transfer]




C08_A_3(2ZK6)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(4XUM)
PPARG_HUMAN
[Raw transfer]




NRO_A_3(2ZK5)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZVT)
PPARG_HUMAN
[Raw transfer]




CEK_A_3(3LMP)
PPARG_HUMAN
[Raw transfer]




C08_B_4(2ZK6)
PPARG_HUMAN
[Raw transfer]




MLO_A_3(3R5N)
PPARG_HUMAN
[Raw transfer]




RRH_A_3(4E4Q)
PPARG_HUMAN
[Raw transfer]




XPT_B_4(3PO9)
PPARG_HUMAN
[Raw transfer]




TBY_B_4(3WJ4)
PPARG_HUMAN
[Raw transfer]




NRO_B_4(2ZK5)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADS)
PPARG_HUMAN
[Raw transfer]




Z12_A_3(3FUR)
PPARG_HUMAN
[Raw transfer]




SP0_C_3(2G0G)
PPARG_HUMAN
[Raw transfer]




66B_B_4(3X1I)
PPARG_HUMAN
[Raw transfer]




PLB_D_12(3DZU)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(4XUM)
PPARG_HUMAN
[Raw transfer]




YFB_B_4(4A4W)
PPARG_HUMAN
[Raw transfer]




DIF_A_2(4OJ4)
PPARG_HUMAN
[Raw transfer]




LU2_B_5(3SZ1)
PPARG_HUMAN
[Raw transfer]




FCM_A_3(4F9M)
PPARG_HUMAN
[Raw transfer]




YFD_B_4(4A4V)
PPARG_HUMAN
[Raw transfer]




OCX_B_4(2ZK3)
PPARG_HUMAN
[Raw transfer]




KRC_A_3(3B1M)
PPARG_HUMAN
[Raw transfer]




SP3_D_4(2G0H)
PPARG_HUMAN
[Raw transfer]




XPT_A_3(3PO9)
PPARG_HUMAN
[Raw transfer]




OCR_B_4(2ZK4)
PPARG_HUMAN
[Raw transfer]




XDI_A_3(3OSW)
PPARG_HUMAN
[Raw transfer]




F22_B_4(2VV0)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADX)
PPARG_HUMAN
[Raw transfer]




SP3_C_3(2G0H)
PPARG_HUMAN
[Raw transfer]




Z27_B_5(3K8S)
PPARG_HUMAN
[Raw transfer]




PTG_A_4(2ZK2)
PPARG_HUMAN
[Raw transfer]




OCR_B_5(3ADW)
PPARG_HUMAN
[Raw transfer]




9HO_A_4(2VSR)
PPARG_HUMAN
[Raw transfer]




9HO_B_5(2VSR)
PPARG_HUMAN
[Raw transfer]




MYI_B_7(3ADU)
PPARG_HUMAN
[Raw transfer]




XDH_A_3(3OSI)
PPARG_HUMAN
[Raw transfer]




MSZ_A_3(4PWL)
PPARG_HUMAN
[Raw transfer]




MYI_A_3(3ADW)
PPARG_HUMAN
[Raw transfer]




SRO_A_3(3ADV)
PPARG_HUMAN
[Raw transfer]




5HE_B_5(2VV2)
PPARG_HUMAN
[Raw transfer]




SRO_B_5(3ADV)
PPARG_HUMAN
[Raw transfer]




KNA_A_4(3SZ1)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZK1)
PPARG_HUMAN
[Raw transfer]




13 PsiBlast_PDB 92.16100%-170 - C5 -2P54 9.4 PPARA_HUMAN
27 PsiBlast_CBE 91.71100%-164 - C5 -3ET1 6.1 PPARA_HUMAN
25 PsiBlast_CBE 90.5999%-171 - C5 -3KDU 11.5 PPARA_HUMAN
28 PsiBlast_CBE 90.2999%-172 - C5 -2NPA 9.4 PPARA_HUMAN
26 PsiBlast_CBE 90.1799%-171 - C5 -3KDT 8.1 PPARA_HUMAN
6 PsiBlast_PDB 89.87100%-163 - C5 -3SP6 8.0 PPARA_HUMAN
4 PsiBlast_PDB 89.5899%-182 - C5 -3KDT 8.9 PPARA_HUMAN
11 PsiBlast_PDB 89.5699%-157 - C5 -2NPA 9.2 PPARA_HUMAN
5 PsiBlast_PDB 89.0299%-173 - C5 -3KDU 11.2 PPARA_HUMAN
8 PsiBlast_PDB 88.87100%-163 - C5 -3ET1 7.1 PPARA_HUMAN
2 PsiBlast_PDB 88.87100%-163 - C5 -4BCR 5.6 PPARA_HUMAN
24 PsiBlast_CBE 88.72100%-169 - C5 -4BCR 5.2 PPARA_HUMAN
3 PsiBlast_PDB 88.11100%-179 - C5 -4CI4 8.5 PPARA_HUMAN
7 PsiBlast_PDB 87.51100%-176 - C5 -3G8I 9.5 PPARA_HUMAN
15 PsiBlast_PDB 87.0799%-174 - C5 -5AZT 6.1 PPARA_HUMAN
10 PsiBlast_PDB 86.65100%-161 - C5 -3VI8 11.2 PPARA_HUMAN
32 PsiBlast_CBE 86.6199%-168 - C5 -5AZT 5.0 PPARA_HUMAN
14 PsiBlast_PDB 86.43100%-174 - C5 -3FEI 7.5 PPARA_HUMAN
29 PsiBlast_CBE 86.11100%-160 - C5 -1KKQ 11.3 PPARA_HUMAN
30 PsiBlast_CBE 86.10100%-166 - C5 -1KKQ 10.8 PPARA_HUMAN
268 HHSearch 86.05100%-161 - C5 -3VI8 11.2 PPARA_HUMAN
9 PsiBlast_PDB 86.01100%-162 - C5 -2ZNN 11.1 PPARA_HUMAN
16 PsiBlast_PDB 85.9862%-150 - C5 -3DZU 5.5 PPARG_HUMAN
31 PsiBlast_CBE 85.80100%-165 - C5 -1KKQ 10.7 PPARA_HUMAN
12 PsiBlast_PDB 85.26100%-164 - C5 -1KKQ 10.7 PPARA_HUMAN
62 PsiBlast_CBE 80.4770%-179 - C5 -2AWH 5.1 PPARD_HUMAN
63 PsiBlast_CBE 80.4470%-174 - C5 -2AWH 5.8 PPARD_HUMAN
67 PsiBlast_CBE 80.4070%-182 - C5 -2BAW 6.3 PPARD_HUMAN
109 PsiBlast_CBE 78.9961%-168 - C5 -4HEE 9.9 PPARG_HUMAN
152 PsiBlast_CBE 78.9861%-162 - C5 -3G9E 5.4 PPARG_HUMAN
158 PsiBlast_CBE 78.9561%-160 - C5 -2GTK 7.5 PPARG_HUMAN
118 PsiBlast_CBE 78.9461%-164 - C5 -3V9T 7.7 PPARG_HUMAN
131 PsiBlast_CBE 78.6161%-161 - C5 -3ET3 5.9 PPARG_HUMAN
119 PsiBlast_CBE 78.4461%-153 - C5 -3LMP 6.1 PPARG_HUMAN
141 PsiBlast_CBE 78.4361%-161 - C5 -2POB 8.7 PPARG_HUMAN
246 PsiBlast_CBE 78.4260%-166 - C5 -3OSW 6.8 PPARG_HUMAN
156 PsiBlast_CBE 78.2361%-161 - C5 -2HWR 8.2 PPARG_HUMAN
114 PsiBlast_CBE 78.1661%-165 - C5 -1I7I 5.7 PPARG_HUMAN
115 PsiBlast_CBE 78.1361%-161 - C5 -4F9M 5.9 PPARG_HUMAN
251 PsiBlast_CBE 78.1160%-157 - C5 -4R6S 6.5 PPARG_HUMAN
101 PsiBlast_CBE 78.1060%-162 - C5 -3ADS 7.1 PPARG_HUMAN
189 PsiBlast_CBE 78.0761%-159 - C5 -5AZV 4.5 PPARG_HUMAN
181 PsiBlast_CBE 78.0661%-162 - C5 -2OM9 6.2 PPARG_HUMAN
175 PsiBlast_CBE 78.0461%-153 - C5 -4XUH 7.8 PPARG_HUMAN
179 PsiBlast_CBE 78.0161%-162 - C5 -2OM9 6.9 PPARG_HUMAN
173 PsiBlast_CBE 77.9761%-157 - C5 -4XUM 3.0 PPARG_HUMAN
133 PsiBlast_CBE 77.9661%-156 - C5 -4CI5 7.1 PPARG_HUMAN
103 PsiBlast_CBE 77.9660%-156 - C5 -2YFE 6.1 PPARG_HUMAN
153 PsiBlast_CBE 77.9461%-160 - C5 -3FEJ 5.6 PPARG_HUMAN
74 PsiBlast_CBE 77.9559%-157 - C5 -3VN2 8.3 PPARG_HUMAN
116 PsiBlast_CBE 77.9461%-159 - C5 -3V9Y 8.0 PPARG_HUMAN
247 PsiBlast_CBE 77.8860%-162 - C5 -3OSI 7.1 PPARG_HUMAN