@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR1C2_PPARb: (2016-11-24 )
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Atome Classification :

(171 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IL2_B_4(3SP9)
PPARD_HUMAN
[Raw transfer]




IL2_A_3(3SP9)
PPARD_HUMAN
[Raw transfer]




3EQ_A_3(3PEQ)
PPARD_HUMAN
[Raw transfer]




VCA_B_8(2B50)
PPARD_HUMAN
[Raw transfer]




L41_B_4(3D5F)
PPARD_HUMAN
[Raw transfer]




3EQ_B_10(3PEQ)
PPARD_HUMAN
[Raw transfer]




L41_A_3(3D5F)
PPARD_HUMAN
[Raw transfer]




VCA_A_7(2B50)
PPARD_HUMAN
[Raw transfer]




VCA_E_5(2AWH)
PPARD_HUMAN
[Raw transfer]




VCA_F_6(2AWH)
PPARD_HUMAN
[Raw transfer]




S44_A_2(2ZNN)
PPARA_HUMAN
[Raw transfer]




IL2_A_3(3SP6)
PPARA_HUMAN
[Raw transfer]




VCA_F_6(2BAW)
PPARD_HUMAN
[Raw transfer]




735_C_3(2P54)
PPARA_HUMAN
[Raw transfer]




DRD_A_3(2HWR)
PPARG_HUMAN
[Raw transfer]




5BC_A_3(3NOA)
PPARG_HUMAN
[Raw transfer]




GW0_A_2(3TKM)
PPARD_HUMAN
[Raw transfer]




RO7_A_3(3G9E)
PPARG_HUMAN
[Raw transfer]




331_N_14(1Y0S)
PPARD_HUMAN
[Raw transfer]




331_O_15(1Y0S)
PPARD_HUMAN
[Raw transfer]




GNI_B_4(2J14)
PPARD_HUMAN
[Raw transfer]




K55_A_4(2ZNP)
PPARD_HUMAN
[Raw transfer]




401_B_6(2ZNQ)
PPARD_HUMAN
[Raw transfer]




NKS_A_3(3KDU)
PPARA_HUMAN
[Raw transfer]




WLM_A_3(2XYJ)
PPARD_HUMAN
[Raw transfer]




DRJ_C_3(2I4J)
PPARG_HUMAN
[Raw transfer]




WLM_B_6(2XYJ)
PPARD_HUMAN
[Raw transfer]




3EA_D_4(2ATH)
PPARG_HUMAN
[Raw transfer]




AZ2_C_3(1I7I)
PPARG_HUMAN
[Raw transfer]




24L_A_3(3V9Y)
PPARG_HUMAN
[Raw transfer]




Y1N_A_2(4CI4)
PPARA_HUMAN
[Raw transfer]




UNT_A_3(3IA6)
PPARG_HUMAN
[Raw transfer]




208_A_3(2GTK)
PPARG_HUMAN
[Raw transfer]




ET1_B_7(3ET2)
PPARD_HUMAN
[Raw transfer]




MMB_A_5(2NPA)
PPARA_HUMAN
[Raw transfer]




K55_B_6(2ZNP)
PPARD_HUMAN
[Raw transfer]




3EA_C_3(2ATH)
PPARG_HUMAN
[Raw transfer]




401_A_4(2ZNQ)
PPARD_HUMAN
[Raw transfer]




MMB_C_6(2NPA)
PPARA_HUMAN
[Raw transfer]




AZ2_D_4(1I7I)
PPARG_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




EK1_A_3(3VSO)
PPARG_HUMAN
[Raw transfer]




08S_A_3(2XYW)
PPARD_HUMAN
[Raw transfer]




T53_A_3(5DVC)
?
[Raw transfer]




4HD_A_3(2VV1)
PPARG_HUMAN
[Raw transfer]




CTM_A_3(3FEJ)
PPARG_HUMAN
[Raw transfer]




3OZ_A_2(3OZ0)
PPARD_HUMAN
[Raw transfer]




L92_A_3(2Q8S)
PPARG_HUMAN
[Raw transfer]




538_D_6(3KMG)
PPARG_HUMAN
[Raw transfer]




GNI_A_3(2J14)
PPARD_HUMAN
[Raw transfer]




ET1_A_3(3ET3)
PPARG_HUMAN
[Raw transfer]




Z00_B_5(2XYX)
PPARD_HUMAN
[Raw transfer]




Y1N_A_3(4CI5)
PPARG_HUMAN
[Raw transfer]




DY6_A_4(3DY6)
PPARD_HUMAN
[Raw transfer]




NKS_B_4(3KDU)
PPARA_HUMAN
[Raw transfer]




DY6_B_5(3DY6)
PPARD_HUMAN
[Raw transfer]




Z00_A_3(2XYX)
PPARD_HUMAN
[Raw transfer]




B05_A_3(5DV3)
PPARG_HUMAN
[Raw transfer]




DRH_A_3(2I4Z)
PPARG_HUMAN
[Raw transfer]




08S_B_5(2XYW)
PPARD_HUMAN
[Raw transfer]




ET1_A_3(3ET2)
PPARD_HUMAN
[Raw transfer]




ZAA_A_2(3BC5)
PPARG_HUMAN
[Raw transfer]




5OX_A_3(3X1H)
PPARG_HUMAN
[Raw transfer]




ET1_A_5(3ET1)
PPARA_HUMAN
[Raw transfer]




CTM_A_3(3FEI)
PPARA_HUMAN
[Raw transfer]




ET1_B_6(3ET1)
PPARA_HUMAN
[Raw transfer]




9HO_A_3(2VSR)
PPARG_HUMAN
[Raw transfer]




RO7_A_3(3G8I)
PPARA_HUMAN
[Raw transfer]




M7S_A_3(3AN3)
PPARG_HUMAN
[Raw transfer]




C01_C_3(1ZEO)
PPARG_HUMAN
[Raw transfer]




M7R_A_3(3AN4)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3B3K)
PPARG_HUMAN
[Raw transfer]




14R_X_3(4HEE)
PPARG_HUMAN
[Raw transfer]




4R8_A_3(2VV3)
PPARG_HUMAN
[Raw transfer]




538_A_5(3KMG)
PPARG_HUMAN
[Raw transfer]




EPA_A_3(3GWX)
PPARD_HUMAN
[Raw transfer]




3JX_D_4(4R2U)
PPARG_HUMAN
[Raw transfer]




DRY_A_3(2HWQ)
PPARG_HUMAN
[Raw transfer]




486_A_3(3QT0)
PPARG_HUMAN
[Raw transfer]




TLS_A_3(3VN2)
PPARG_HUMAN
[Raw transfer]




1FA_A_3(2Q5G)
PPARD_HUMAN
[Raw transfer]




3JX_A_3(4R2U)
PPARG_HUMAN
[Raw transfer]




J35_A_3(3VJH)
PPARG_HUMAN
[Raw transfer]




ZZH_A_3(3HOD)
PPARG_HUMAN
[Raw transfer]




GRR_A_3(3CDS)
PPARG_HUMAN
[Raw transfer]




F22_A_3(2VV0)
PPARG_HUMAN
[Raw transfer]




7HA_B_4(3KDT)
PPARA_HUMAN
[Raw transfer]




EK8_A_3(3VSP)
PPARG_HUMAN
[Raw transfer]




DRH_C_3(2I4P)
PPARG_HUMAN
[Raw transfer]




7HA_A_3(3KDT)
PPARA_HUMAN
[Raw transfer]




4M5_A_3(5AZV)
PPARG_HUMAN
[Raw transfer]




LNA_A_5(3CWD)
PPARG_HUMAN
[Raw transfer]




OCX_A_3(2ZK3)
PPARG_HUMAN
[Raw transfer]




GW4_A_3(2POB)
PPARG_HUMAN
[Raw transfer]




RRG_A_4(4E4K)
PPARG_HUMAN
[Raw transfer]




17L_A_3(3V9T)
PPARG_HUMAN
[Raw transfer]




M0T_A_3(3S9S)
PPARG_HUMAN
[Raw transfer]




MYI_A_4(3ADU)
PPARG_HUMAN
[Raw transfer]




240_B_4(2Q59)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADX)
PPARG_HUMAN
[Raw transfer]




HIG_A_3(3R8A)
PPARG_HUMAN
[Raw transfer]




YRG_A_3(3CDP)
PPARG_HUMAN
[Raw transfer]




NSI_D_4(2HFP)
PPARG_HUMAN
[Raw transfer]




LRG_A_2(4L96)
PPARG_HUMAN
[Raw transfer]




4M5_A_4(5AZT)
PPARA_HUMAN
[Raw transfer]




PTG_A_3(2ZVT)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(4L98)
PPARG_HUMAN
[Raw transfer]




1FA_B_4(2Q5G)
PPARD_HUMAN
[Raw transfer]




LNA_B_7(3CWD)
PPARG_HUMAN
[Raw transfer]




JJA_A_3(3WMH)
PPARG_HUMAN
[Raw transfer]




LRG_B_4(4L98)
PPARG_HUMAN
[Raw transfer]




4M5_B_5(5AZT)
PPARA_HUMAN
[Raw transfer]




SFI_B_6(4XUH)
PPARG_HUMAN
[Raw transfer]




DKD_A_3(3HO0)
PPARG_HUMAN
[Raw transfer]




IMN_A_3(4XUM)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADS)
PPARG_HUMAN
[Raw transfer]




EPA_B_4(3GWX)
PPARD_HUMAN
[Raw transfer]




GW9_B_4(3B0R)
PPARG_HUMAN
[Raw transfer]




B4H_A_3(5DV6)
PPARG_HUMAN
[Raw transfer]




RO0_C_3(2FVJ)
PPARG_HUMAN
[Raw transfer]




SFI_A_4(4XUH)
PPARG_HUMAN
[Raw transfer]




6BH_A_3(5DSH)
PPARG_HUMAN
[Raw transfer]




SF2_B_4(2Q6R)
PPARG_HUMAN
[Raw transfer]




243_B_4(2VST)
PPARG_HUMAN
[Raw transfer]




21L_A_3(3V9V)
PPARG_HUMAN
[Raw transfer]




T9T_B_4(3WJ5)
PPARG_HUMAN
[Raw transfer]




YFD_A_3(4A4V)
PPARG_HUMAN
[Raw transfer]




MLO_A_3(3R5N)
PPARG_HUMAN
[Raw transfer]




SP0_C_3(2G0G)
PPARG_HUMAN
[Raw transfer]




241_A_3(2Q5P)
PPARG_HUMAN
[Raw transfer]




SF1_A_4(2Q61)
PPARG_HUMAN
[Raw transfer]




243_A_3(2VST)
PPARG_HUMAN
[Raw transfer]




4HD_B_4(2VV1)
PPARG_HUMAN
[Raw transfer]




TBY_A_3(3WJ4)
PPARG_HUMAN
[Raw transfer]




4M5_B_4(5AZV)
PPARG_HUMAN
[Raw transfer]




T9T_A_3(3WJ5)
PPARG_HUMAN
[Raw transfer]




KRC_A_3(3B1M)
PPARG_HUMAN
[Raw transfer]




FCM_A_3(4F9M)
PPARG_HUMAN
[Raw transfer]




SF2_A_3(2Q6R)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZK1)
PPARG_HUMAN
[Raw transfer]




Z12_A_3(3FUR)
PPARG_HUMAN
[Raw transfer]




C08_A_3(2ZK6)
PPARG_HUMAN
[Raw transfer]




YFE_B_4(2YFE)
PPARG_HUMAN
[Raw transfer]




TBY_B_4(3WJ4)
PPARG_HUMAN
[Raw transfer]




XPT_B_4(3PO9)
PPARG_HUMAN
[Raw transfer]




471_K_11(1KKQ)
PPARA_HUMAN
[Raw transfer]




471_L_12(1KKQ)
PPARA_HUMAN
[Raw transfer]




SP3_C_3(2G0H)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADX)
PPARG_HUMAN
[Raw transfer]




PTG_A_4(2ZK2)
PPARG_HUMAN
[Raw transfer]




OCR_B_4(2ZK4)
PPARG_HUMAN
[Raw transfer]




YFB_B_4(4A4W)
PPARG_HUMAN
[Raw transfer]




SP3_D_4(2G0H)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZK1)
PPARG_HUMAN
[Raw transfer]




MYI_B_7(3ADU)
PPARG_HUMAN
[Raw transfer]




471_J_10(1KKQ)
PPARA_HUMAN
[Raw transfer]




F22_B_4(2VV0)
PPARG_HUMAN
[Raw transfer]




OCX_B_4(2ZK3)
PPARG_HUMAN
[Raw transfer]




MYI_A_3(3ADW)
PPARG_HUMAN
[Raw transfer]




Z27_B_5(3K8S)
PPARG_HUMAN
[Raw transfer]




WY1_A_5(4BCR)
PPARA_HUMAN
[Raw transfer]




GW9_D_12(3E00)
PPARG_HUMAN
[Raw transfer]




471_I_9(1KKQ)
PPARA_HUMAN
[Raw transfer]




YFD_B_4(4A4V)
PPARG_HUMAN
[Raw transfer]




XDI_A_3(3OSW)
PPARG_HUMAN
[Raw transfer]




WY1_B_8(4BCR)
PPARA_HUMAN
[Raw transfer]




HID_A_4(3ADT)
PPARG_HUMAN
[Raw transfer]




KNA_A_4(3SZ1)
PPARG_HUMAN
[Raw transfer]




5HE_B_5(2VV2)
PPARG_HUMAN
[Raw transfer]




SRO_A_4(3ADV)
PPARG_HUMAN
[Raw transfer]




17 PsiBlast_PDB 90.97100%-172 - C4 -3SP9 8.5 PPARD_HUMAN
34 PsiBlast_CBE 89.8599%-170 - C4 -2B50 7.7 PPARD_HUMAN
15 PsiBlast_PDB 89.69100%-171 - C4 -3TKM 9.1 PPARD_HUMAN
12 PsiBlast_PDB 89.57100%-164 - C4 -3GWX 6.4 PPARD_HUMAN
35 PsiBlast_CBE 89.44100%-167 - C4 -3SP9 8.2 PPARD_HUMAN
13 PsiBlast_PDB 89.14100%-179 - C4 -3DY6 8.1 PPARD_HUMAN
31 PsiBlast_CBE 89.01100%-157 - C4 -3GWX 5.6 PPARD_HUMAN
16 PsiBlast_PDB 88.7899%-171 - C4 -2B50 7.3 PPARD_HUMAN
24 PsiBlast_CBE 88.76100%-158 - C4 -2XYX 8.8 PPARD_HUMAN
4 PsiBlast_PDB 88.7199%-166 - C4 -3ET2 7.4 PPARD_HUMAN
32 PsiBlast_CBE 88.67100%-178 - C4 -3DY6 8.5 PPARD_HUMAN
6 PsiBlast_PDB 88.52100%-165 - C4 -2XYW 9.6 PPARD_HUMAN
7 PsiBlast_PDB 88.43100%-164 - C4 -2XYX 8.6 PPARD_HUMAN
23 PsiBlast_CBE 88.3899%-166 - C4 -3ET2 6.9 PPARD_HUMAN
10 PsiBlast_PDB 88.27100%-168 - C4 -1Y0S 8.6 PPARD_HUMAN
9 PsiBlast_PDB 88.27100%-165 - C4 -2ZNQ 8.7 PPARD_HUMAN
27 PsiBlast_CBE 88.26100%-165 - C4 -2ZNQ 8.8 PPARD_HUMAN
26 PsiBlast_CBE 87.94100%-166 - C4 -2XYJ 8.4 PPARD_HUMAN
5 PsiBlast_PDB 87.88100%-153 - C4 -2XYJ 8.3 PPARD_HUMAN
40 PsiBlast_CBE 87.7062%-147 - C4 -3E00 4.4 PPARG_HUMAN
25 PsiBlast_CBE 87.66100%-163 - C4 -2XYW 9.8 PPARD_HUMAN
30 PsiBlast_CBE 87.63100%-176 - C4 -3PEQ 10.6 PPARD_HUMAN
28 PsiBlast_CBE 87.60100%-165 - C4 -2ZNP 9.9 PPARD_HUMAN
14 PsiBlast_PDB 87.54100%-172 - C4 -3PEQ 10.4 PPARD_HUMAN
3 PsiBlast_PDB 87.4199%-171 - C4 -3OZ0 10.2 PPARD_HUMAN
38 PsiBlast_CBE 87.1699%-168 - C4 -3D5F 9.2 PPARD_HUMAN
29 PsiBlast_CBE 87.11100%-167 - C4 -1Y0S 9.0 PPARD_HUMAN
8 PsiBlast_PDB 86.86100%-169 - C4 -2ZNP 9.3 PPARD_HUMAN
37 PsiBlast_CBE 86.8599%-172 - C4 -3D5F 8.7 PPARD_HUMAN
36 PsiBlast_CBE 86.7499%-177 - C4 -2AWH 6.6 PPARD_HUMAN
19 PsiBlast_PDB 85.8599%-172 - C4 -2AWH 7.1 PPARD_HUMAN
2 PsiBlast_PDB 85.7799%-168 - C4 -2J14 10.1 PPARD_HUMAN
39 PsiBlast_CBE 85.5499%-178 - C4 -2BAW 6.6 PPARD_HUMAN
22 PsiBlast_CBE 84.2699%-160 - C4 -2J14 10.3 PPARD_HUMAN
49 PsiBlast_CBE 83.8769%-169 - C4 -3KDU 9.7 PPARA_HUMAN
50 PsiBlast_CBE 82.6269%-171 - C4 -3KDU 10.6 PPARA_HUMAN
52 PsiBlast_CBE 82.2069%-175 - C4 -3KDT 6.4 PPARA_HUMAN
66 PsiBlast_CBE 82.1270%-165 - C4 -2P54 7.3 PPARA_HUMAN
53 PsiBlast_CBE 81.9869%-161 - C4 -3SP6 7.3 PPARA_HUMAN
63 PsiBlast_CBE 81.8369%-166 - C4 -2NPA 5.5 PPARA_HUMAN
21 PsiBlast_CBE 81.8399%-178 - C4 -2Q5G 11.4 PPARD_HUMAN
55 PsiBlast_CBE 81.6470%-159 - C4 -3ET1 6.1 PPARA_HUMAN
51 PsiBlast_CBE 81.5669%-166 - C4 -3KDT 5.6 PPARA_HUMAN
47 PsiBlast_CBE 80.9269%-165 - C4 -4BCR 5.1 PPARA_HUMAN
56 PsiBlast_CBE 80.8070%-159 - C4 -3ET1 6.5 PPARA_HUMAN
48 PsiBlast_CBE 80.6269%-160 - C4 -4BCR 5.7 PPARA_HUMAN
166 PsiBlast_CBE 80.2961%-156 - C4 -3CDP 4.9 PPARG_HUMAN
270 HHSearch 80.2771%-161 - C4 -3VI8 9.6 PPARA_HUMAN
46 PsiBlast_CBE 79.9069%-176 - C4 -4CI4 6.9 PPARA_HUMAN
54 PsiBlast_CBE 79.8970%-170 - C4 -3G8I 8.7 PPARA_HUMAN
183 PsiBlast_CBE 79.8461%-151 - C4 -2I4Z 6.4 PPARG_HUMAN
180 PsiBlast_CBE 79.8161%-152 - C4 -2ZK2 4.3 PPARG_HUMAN
57 PsiBlast_CBE 79.8170%-159 - C4 -3VI8 7.8 PPARA_HUMAN
67 PsiBlast_CBE 79.8070%-164 - C4 -5AZT 4.5 PPARA_HUMAN
161 PsiBlast_CBE 79.7661%-159 - C4 -3VJH 4.9 PPARG_HUMAN
64 PsiBlast_CBE 79.7369%-151 - C4 -2NPA 7.8 PPARA_HUMAN
86 PsiBlast_CBE 79.5961%-158 - C4 -4A4V 4.9 PPARG_HUMAN
216 PsiBlast_CBE 79.4962%-162 - C4 -3B1M 7.5 PPARG_HUMAN
212 PsiBlast_CBE 79.4762%-160 - C4 -3V9Y 8.1 PPARG_HUMAN
58 PsiBlast_CBE 79.4670%-159 - C4 -2ZNN 9.9 PPARA_HUMAN
185 PsiBlast_CBE 79.3461%-153 - C4 -2I4J 6.0 PPARG_HUMAN
244 PsiBlast_CBE 79.2762%-160 - C4 -2GTK 6.7 PPARG_HUMAN
89 PsiBlast_CBE 79.2561%-153 - C4 -3ADX 6.7 PPARG_HUMAN
238 PsiBlast_CBE 79.1362%-163 - C4 -3G9E 5.9 PPARG_HUMAN
91 PsiBlast_CBE 79.1261%-159 - C4 -3ADW 3.8 PPARG_HUMAN
162