@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR1F3_RORg: (2016-11-24 )
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK

Atome Classification :

(60 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NBH_B_7(4NIE)

[Raw transfer]




NBH_A_5(4NIE)
RORG_HUMAN
[Raw transfer]




3QQ_B_8(4WLB)

[Raw transfer]




4D8_A_3(4S14)

[Raw transfer]




3QQ_A_5(4WLB)
RORG_HUMAN
[Raw transfer]




HC3_B_6(3L0L)

[Raw transfer]




HC3_A_5(3L0L)
RORG_HUMAN
[Raw transfer]




HC2_A_3(3KYT)

[Raw transfer]




43V_A_3(4XT9)
?
[Raw transfer]




3SX_B_6(4WQP)

[Raw transfer]




39K_C_5(4QM0)

[Raw transfer]




3SX_A_4(4WQP)
RORG_HUMAN
[Raw transfer]




4D8_A_5(4S15)
RORA_HUMAN
[Raw transfer]




4D8_B_7(4S15)

[Raw transfer]




C3S_B_2(1S0X)

[Raw transfer]




HC9_A_3(3L0J)

[Raw transfer]




ARL_A_3(1NQ7)
RORB_RAT
[Raw transfer]




3SN_A_5(4WPF)
RORG_HUMAN
[Raw transfer]




39K_A_3(4QM0)
RORG_HUMAN
[Raw transfer]




4LQ_A_3(5AYG)
RORG_HUMAN
[Raw transfer]




DGX_A_3(3B0W)
RORG_HUMAN
[Raw transfer]




4Q3_D_8(4ZOM)
?
[Raw transfer]




4Q3_B_6(4ZOM)

[Raw transfer]




DGX_B_4(3B0W)

[Raw transfer]




4LQ_B_4(5AYG)

[Raw transfer]




3SN_D_6(4WPF)
RORG_HUMAN
[Raw transfer]




5RT_A_3(5ETH)

[Raw transfer]




VYI_A_3(5APH)
RORG_HUMAN
[Raw transfer]




VYI_A_3(5APH)
RORG_HUMAN
[Raw transfer]




4Q3_A_5(4ZOM)
RORG_HUMAN
[Raw transfer]




4Q3_C_7(4ZOM)
?
[Raw transfer]




5RT_B_4(5ETH)
?
[Raw transfer]




6EW_B_4(5IXK)
?
[Raw transfer]




6F1_D_25(5IZ0)
?
[Raw transfer]




CLR_B_2(1N83)

[Raw transfer]




6F1_B_18(5IZ0)
?
[Raw transfer]




6F1_A_9(5IZ0)

[Raw transfer]




6EW_A_3(5IXK)

[Raw transfer]




YTZ_A_5(5G44)

[Raw transfer]




76E_A_3(5APJ)

[Raw transfer]




CLR_B_2(1N83)

[Raw transfer]




4P3_D_8(4ZJR)
?
[Raw transfer]




76E_A_4(5APK)

[Raw transfer]




4P1_A_3(4ZJW)
RORG_HUMAN
[Raw transfer]




4P3_B_6(4ZJR)
?
[Raw transfer]




444_B_4(4NB6)

[Raw transfer]




5IM_A_3(5G43)
RORG_HUMAN
[Raw transfer]




76E_B_5(5APK)
?
[Raw transfer]




4P3_C_7(4ZJR)
?
[Raw transfer]




4P3_A_5(4ZJR)

[Raw transfer]




444_A_3(4NB6)
RORG_HUMAN
[Raw transfer]




444_B_6(5EJV)
?
[Raw transfer]




A7W_A_3(5G45)

[Raw transfer]




444_A_5(5EJV)

[Raw transfer]




4F1_A_2(4YPQ)

[Raw transfer]




4Y7_A_2(5C4U)

[Raw transfer]




4Y5_A_2(5C4S)
RORG_HUMAN
[Raw transfer]




4TU_A_3(5G42)
RORG_HUMAN
[Raw transfer]




4F1_A_2(5C4O)
?
[Raw transfer]




4Y6_A_2(5C4T)

[Raw transfer]




17 PsiBlast_PDB 85.94100%-181 - C3 -4YPQ 11.2
13 PsiBlast_PDB 85.93100%-173 - C3 -3KYT 8.3
37 PsiBlast_CBE 85.64100%-178 - C3 -5G44 4.6
8 PsiBlast_PDB 85.5599%-179 - C3 -4NIE 9.1 RORG_HUMAN
27 PsiBlast_CBE 85.47100%-176 - C3 -4WPF 8.2 RORG_HUMAN
1 PsiBlast_PDB 85.43100%-180 - C3 -5EJV 5.6
11 PsiBlast_PDB 85.31100%-172 - C3 -4WLB 7.4 RORG_HUMAN
32 PsiBlast_CBE 85.16100%-174 - C3 -4WLB 7.5
4 PsiBlast_PDB 85.15100%-169 - C3 -4S14 8.2
36 PsiBlast_CBE 85.12100%-177 - C3 -5G45 4.3
43 PsiBlast_CBE 84.8999%-170 - C3 -5C4O 11.7 ?
7 PsiBlast_PDB 84.78100%-173 - C3 -4WPF 7.4 RORG_HUMAN
40 PsiBlast_CBE 84.6499%-172 - C3 -5C4U 11.7
28 PsiBlast_CBE 84.6499%-169 - C3 -4NIE 9.5
42 PsiBlast_CBE 84.4799%-174 - C3 -5C4S 11.9 RORG_HUMAN
16 PsiBlast_PDB 84.47100%-174 - C3 -4XT9 10.1 ?
6 PsiBlast_PDB 84.39100%-165 - C3 -3L0L 9.0 RORG_HUMAN
14 PsiBlast_PDB 84.24100%-172 - C3 -3L0J 8.7
3 PsiBlast_PDB 84.2499%-172 - C3 -5IZ0 7.1
24 PsiBlast_CBE 84.2299%-176 - C3 -5IZ0 6.7 ?
38 PsiBlast_CBE 84.14100%-170 - C3 -5G43 3.2 RORG_HUMAN
25 PsiBlast_CBE 84.0699%-172 - C3 -5IZ0 6.7 ?
26 PsiBlast_CBE 84.02100%-159 - C3 -3L0L 8.7
19 PsiBlast_PDB 83.78100%-174 - C3 -5APH 7.7 RORG_HUMAN
21 PsiBlast_CBE 83.73100%-172 - C3 -5EJV 5.6 ?
39 PsiBlast_CBE 83.58100%-176 - C3 -5G42 4.1 RORG_HUMAN
41 PsiBlast_CBE 83.2399%-171 - C3 -5C4T 11.8
20 PsiBlast_PDB 83.23100%-172 - C3 -5APJ 7.5
12 PsiBlast_PDB 83.02100%-169 - C3 -4WQP 8.3 RORG_HUMAN
10 PsiBlast_PDB 82.62100%-166 - C3 -4QM0 7.0 RORG_HUMAN
106 HHSearch 82.54100%-174 - C3 -5APH 7.7 RORG_HUMAN
34 PsiBlast_CBE 81.83100%-164 - C3 -5APK 8.1 ?
29 PsiBlast_CBE 81.75100%-162 - C3 -4QM0 7.1
18 PsiBlast_PDB 81.66100%-175 - C3 -5APK 7.8
47 PsiBlast_CBE 81.54100%-182 - C3 -4ZOM 9.6 ?
55 PsiBlast_CBE 81.37100%-187 - C3 -5ETH 8.1 ?
48 PsiBlast_CBE 81.13100%-180 - C3 -4ZOM 9.5
9 PsiBlast_PDB 80.78100%-176 - C3 -4NB6 6.4 RORG_HUMAN
30 PsiBlast_CBE 80.69100%-176 - C3 -4NB6 6.5
49 PsiBlast_CBE 80.63100%-169 - C3 -4ZOM 9.3 RORG_HUMAN
56 PsiBlast_CBE 80.50100%-183 - C3 -5ETH 7.9
31 PsiBlast_CBE 80.16100%-173 - C3 -4WQP 7.9
50 PsiBlast_CBE 80.13100%-183 - C3 -4ZJW 8.9 RORG_HUMAN
44 PsiBlast_CBE 79.2398%-181 - C3 -5IXK 7.1 ?
53 PsiBlast_CBE 79.12100%-157 - C3 -4ZJR 7.4 ?
45 PsiBlast_CBE 78.6398%-178 - C3 -5IXK 6.9
15 PsiBlast_PDB 78.46100%-166 - C3 -3B0W 8.8 RORG_HUMAN
51 PsiBlast_CBE 78.43100%-172 - C3 -4ZJR 8.2 ?
52 PsiBlast_CBE 78.09100%-169 - C3 -4ZJR 8.9 ?
54 PsiBlast_CBE 78.07100%-172 - C3 -4ZJR 8.9
33 PsiBlast_CBE 77.77100%-167 - C3 -3B0W 9.5
22 PsiBlast_CBE 77.75100%-169 - C3 -5AYG 8.6
2 PsiBlast_PDB 77.43100%-168 - C3 -5AYG 8.7 RORG_HUMAN
46 PsiBlast_CBE 76.80100%-166 - C3 -4ZOM 8.7 ?
59 PsiBlast_CBE 69.6952%-135 - C3 -1S0X 8.1
57 PsiBlast_CBE 69.6953%-123 - C3 -4S15 8.2
60 PsiBlast_CBE 69.6852%-136 - C3 -1N83 5.1
58 PsiBlast_CBE 68.9153%-135 - C3 -4S15 8.7 RORA_HUMAN
105 HHSearch 65.4454%-165 - C3 -1N83 5.0
108 HHSearch 65.1854%-154 - C3 -1NQ7 6.3 RORB_RAT