@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR3B3_ERRg: (2016-11-25 )
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TXF_A_6(2EWP)
ERR3_HUMAN
[Raw transfer]




TXF_C_8(2EWP)
ERR3_HUMAN
[Raw transfer]




OHT_A_2(2GPU)

[Raw transfer]




TXF_B_7(2EWP)
ERR3_HUMAN
[Raw transfer]




TXF_D_9(2EWP)
ERR3_HUMAN
[Raw transfer]




TXF_E_10(2EWP)

[Raw transfer]




OHT_D_4(1VJB)
ERR3_HUMAN
[Raw transfer]




OHT_C_3(1VJB)
ERR3_HUMAN
[Raw transfer]




OHT_A_2(2P7Z)
ERR3_HUMAN
[Raw transfer]




GOL_A_4(2ZKC)
ERR3_HUMAN
[Raw transfer]




DES_H_8(1S9P)

[Raw transfer]




2OH_A_2(2E2R)
ERR3_HUMAN
[Raw transfer]




2OH_A_3(2P7G)
ERR3_HUMAN
[Raw transfer]




047_B_4(2PJL)
ERR1_HUMAN
[Raw transfer]




047_A_3(2PJL)
ERR1_HUMAN
[Raw transfer]




1BA_A_5(2GPP)
ERR3_HUMAN
[Raw transfer]




43M_A_2(2P7A)
ERR3_HUMAN
[Raw transfer]




DES_E_5(1S9P)
ERR3_MOUSE
[Raw transfer]




DES_F_6(1S9P)
ERR3_MOUSE
[Raw transfer]




DES_G_7(1S9P)
ERR3_MOUSE
[Raw transfer]




5FB_A_2(3K6P)
ERR1_HUMAN
[Raw transfer]




5FB_A_2(3K6P)
ERR1_HUMAN
[Raw transfer]




CHD_E_5(1S9Q)
ERR3_MOUSE
[Raw transfer]




13 PsiBlast_PDB 85.69100%-127 - C5 -2P7A 4.0 ERR3_HUMAN
36 PsiBlast_CBE 85.66100%-128 - C5 -2EWP 9.0 ERR3_HUMAN
4 PsiBlast_PDB 85.6699%-120 - C5 -2ZKC 2.4 ERR3_HUMAN
18 PsiBlast_PDB 85.15100%-127 - C5 -2EWP 8.6 ERR3_HUMAN
51 HHSearch 85.14100%-123 - C5 -2E2R 7.0 ERR3_HUMAN
14 PsiBlast_PDB 85.00100%-130 - C5 -2P7G 6.8 ERR3_HUMAN
8 PsiBlast_PDB 84.30100%-124 - C5 -2GPP 7.3 ERR3_HUMAN
34 PsiBlast_CBE 83.71100%-131 - C5 -2EWP 8.9 ERR3_HUMAN
35 PsiBlast_CBE 83.04100%-123 - C5 -2EWP 8.8 ERR3_HUMAN
9 PsiBlast_PDB 82.56100%-130 - C5 -2GPU 8.6
32 PsiBlast_CBE 81.71100%-120 - C5 -1S9P 6.5 ERR3_MOUSE
30 PsiBlast_CBE 81.70100%-119 - C5 -1S9P 6.6
33 PsiBlast_CBE 80.17100%-138 - C5 -2EWP 8.6
16 PsiBlast_PDB 79.67100%-120 - C5 -1S9Q 4.4 ERR3_MOUSE
31 PsiBlast_CBE 78.67100%-119 - C5 -1S9P 6.3 ERR3_MOUSE
17 PsiBlast_PDB 77.96100%-113 - C5 -1S9P 6.2 ERR3_MOUSE
28 PsiBlast_CBE 76.94100%-119 - C5 -1VJB 7.0 ERR3_HUMAN
15 PsiBlast_PDB 75.90100%-116 - C5 -2P7Z 7.5 ERR3_HUMAN
11 PsiBlast_PDB 74.78100%-125 - C5 -1VJB 7.4 ERR3_HUMAN
20 PsiBlast_PDB 70.5561%-118 - C5 -3K6P 6.1 ERR1_HUMAN
40 PsiBlast_CBE 67.0060%-109 - C5 -2PJL 8.6 ERR1_HUMAN
39 PsiBlast_CBE 66.8360%-111 - C5 -2PJL 8.6 ERR1_HUMAN
54 HHSearch 66.5063% -93 - C5 -3K6P 6.1 ERR1_HUMAN