@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR1C1_PPARa: (2016-04-07 )
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

S44_A_2(2ZNN)
PPARA_HUMAN
[Raw transfer]




IL2_A_3(3SP6)
PPARA_HUMAN
[Raw transfer]




MMB_A_5(2NPA)
PPARA_HUMAN
[Raw transfer]




Y1N_A_2(4CI4)
PPARA_HUMAN
[Raw transfer]




MMB_C_6(2NPA)
PPARA_HUMAN
[Raw transfer]




735_C_3(2P54)
PPARA_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




RO7_A_3(3G8I)
PPARA_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




ET1_B_6(3ET1)
PPARA_HUMAN
[Raw transfer]




ET1_A_5(3ET1)
PPARA_HUMAN
[Raw transfer]




CTM_A_3(3FEI)
PPARA_HUMAN
[Raw transfer]




WLM_A_3(2XYJ)
PPARD_HUMAN
[Raw transfer]




471_K_11(1KKQ)
PPARA_HUMAN
[Raw transfer]




471_L_12(1KKQ)
PPARA_HUMAN
[Raw transfer]




1FA_A_3(2Q5G)
PPARD_HUMAN
[Raw transfer]




08S_A_3(2XYW)
PPARD_HUMAN
[Raw transfer]




471_I_9(1KKQ)
PPARA_HUMAN
[Raw transfer]




Z00_A_3(2XYX)
PPARD_HUMAN
[Raw transfer]




471_J_10(1KKQ)
PPARA_HUMAN
[Raw transfer]




WY1_A_5(4BCR)
PPARA_HUMAN
[Raw transfer]




WY1_B_8(4BCR)
PPARA_HUMAN
[Raw transfer]




PLB_D_12(3DZU)
PPARG_HUMAN
[Raw transfer]




GW9_D_12(3E00)
PPARG_HUMAN
[Raw transfer]




13 PsiBlast_PDB 91.83100%-146 - C3 -2P54 9.4 PPARA_HUMAN
27 PsiBlast_CBE 91.59100%-141 - C3 -3ET1 6.1 PPARA_HUMAN
28 PsiBlast_CBE 91.5699%-148 - C3 -2NPA 9.4 PPARA_HUMAN
26 PsiBlast_CBE 91.3199%-156 - C- -3KDT - PPARA_HUMAN -
25 PsiBlast_CBE 91.1799%-154 - C- -3KDU - PPARA_HUMAN -
6 PsiBlast_PDB 90.71100%-141 - C3 -3SP6 8.0 PPARA_HUMAN
1 PsiBlast_PDB 90.60100%-145 - C3 -1K7L - PPARA_HUMAN -
11 PsiBlast_PDB 90.2799%-139 - C3 -2NPA 9.2 PPARA_HUMAN
8 PsiBlast_PDB 90.21100%-143 - C3 -3ET1 7.0 PPARA_HUMAN
5 PsiBlast_PDB 89.4799%-157 - C- -3KDU - PPARA_HUMAN -
3 PsiBlast_PDB 89.30100%-153 - C3 -4CI4 8.5 PPARA_HUMAN
2 PsiBlast_PDB 89.30100%-145 - C3 -4BCR 5.6 PPARA_HUMAN
24 PsiBlast_CBE 89.05100%-146 - C3 -4BCR 5.2 PPARA_HUMAN
4 PsiBlast_PDB 88.8599%-160 - C- -3KDT - PPARA_HUMAN -
9 PsiBlast_PDB 87.95100%-143 - C3 -2ZNN 11.2 PPARA_HUMAN
7 PsiBlast_PDB 87.67100%-151 - C3 -3G8I 9.5 PPARA_HUMAN
10 PsiBlast_PDB 87.62100%-142 - C3 -3VI8 11.2 PPARA_HUMAN
34 HHSearch 87.4299%-142 - C3 -3VI8 11.2 PPARA_HUMAN
14 PsiBlast_PDB 87.12100%-149 - C3 -3FEI 7.5 PPARA_HUMAN
29 PsiBlast_CBE 86.17100%-136 - C3 -1KKQ 11.3 PPARA_HUMAN
30 PsiBlast_CBE 85.96100%-140 - C3 -1KKQ 10.8 PPARA_HUMAN
31 PsiBlast_CBE 85.95100%-143 - C3 -1KKQ 10.8 PPARA_HUMAN
12 PsiBlast_PDB 85.33100%-138 - C3 -1KKQ 10.7 PPARA_HUMAN