@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR1B1_RARa: (2017-01-06 )
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

Atome Classification :

(8 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

1NY_A_5(4JYG)
RARB_HUMAN
[Raw transfer]




1NY_B_7(4JYG)
RARB_HUMAN
[Raw transfer]




JYH_B_6(4JYH)
RARB_HUMAN
[Raw transfer]




REA_B_5(3A9E)
RARA_HUMAN
[Raw transfer]




BMS_C_3(1DKF)
RARA_HUMAN
[Raw transfer]




EQO_A_10(3KMZ)
RARA_HUMAN
[Raw transfer]




JYH_A_5(4JYH)
RARB_HUMAN
[Raw transfer]




TTB_A_5(4DM6)
RARB_HUMAN
[Raw transfer]




184_A_2(1FCX)
RARG_HUMAN
[Raw transfer]




REA_B_2(2LBD)
RARG_HUMAN
[Raw transfer]




EQO_B_5(3KMZ)
RARA_HUMAN
[Raw transfer]




REA_J_10(1XDK)
RARB_MOUSE
[Raw transfer]




961_A_2(1EXX)
RARG_HUMAN
[Raw transfer]




REA_B_6(4DM8)
RARB_HUMAN
[Raw transfer]




TTB_B_6(4DM6)
RARB_HUMAN
[Raw transfer]




EQN_A_3(3KMR)
RARA_HUMAN
[Raw transfer]




394_A_2(1EXA)
RARG_HUMAN
[Raw transfer]




REA_A_5(4DM8)
RARB_HUMAN
[Raw transfer]




REA_J_10(1XDK)
RARB_MOUSE
[Raw transfer]




JYI_A_5(4JYI)
RARB_HUMAN
[Raw transfer]




EQN_A_3(3KMR)
RARA_HUMAN
[Raw transfer]




REA_L_12(1XDK)
RARB_MOUSE
[Raw transfer]




564_A_2(1FCY)
RARG_HUMAN
[Raw transfer]




564_A_2(1FCY)
RARG_HUMAN
[Raw transfer]




JYI_B_6(4JYI)
RARB_HUMAN
[Raw transfer]




254_A_2(1FD0)
RARG_HUMAN
[Raw transfer]




LUF_C_6(4DQM)
RARA_HUMAN
[Raw transfer]




TTB_B_2(1XAP)
RARB_HUMAN
[Raw transfer]




REA_B_2(3LBD)
RARG_HUMAN
[Raw transfer]




156_A_2(1FCZ)
RARG_HUMAN
[Raw transfer]




961_B_2(4LBD)
RARG_HUMAN
[Raw transfer]




LUF_A_5(4DQM)
RARA_HUMAN
[Raw transfer]




5 PsiBlast_PDB 92.66100%-132 - C5 -1DKF 10.5 RARA_HUMAN
1 PsiBlast_PDB 92.47100%-125 - C5 -3A9E 8.2 RARA_HUMAN
34 HHSearch 91.29100%-125 - C5 -3KMR 9.9 RARA_HUMAN
2 PsiBlast_PDB 91.29100%-125 - C5 -3KMR 9.9 RARA_HUMAN
6 PsiBlast_PDB 91.08100%-125 - C5 -4DQM 5.6 RARA_HUMAN
23 PsiBlast_CBE 90.56100%-125 - C5 -4DQM 5.9 RARA_HUMAN
3 PsiBlast_PDB 84.83100%-121 - C5 -3KMZ 11.5 RARA_HUMAN
21 PsiBlast_CBE 84.04100%-120 - C5 -3KMZ 11.2 RARA_HUMAN