@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H_NR3B3_ERRg: (2017-01-06 )
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TXF_D_9(2EWP)
ERR3_HUMAN
[Raw transfer]




TXF_C_8(2EWP)
ERR3_HUMAN
[Raw transfer]




TXF_E_10(2EWP)

[Raw transfer]




TXF_A_6(2EWP)
ERR3_HUMAN
[Raw transfer]




OHT_A_2(2GPU)

[Raw transfer]




OHT_A_2(2P7Z)
ERR3_HUMAN
[Raw transfer]




1OH_A_2(2ZAS)
ERR3_HUMAN
[Raw transfer]




OHT_D_4(1VJB)
ERR3_HUMAN
[Raw transfer]




TXF_B_7(2EWP)
ERR3_HUMAN
[Raw transfer]




OHT_C_3(1VJB)
ERR3_HUMAN
[Raw transfer]




2OH_A_3(2P7G)
ERR3_HUMAN
[Raw transfer]




2OH_A_2(2E2R)
ERR3_HUMAN
[Raw transfer]




2OH_A_2(2E2R)
ERR3_HUMAN
[Raw transfer]




DES_H_8(1S9P)

[Raw transfer]




43M_A_2(2P7A)
ERR3_HUMAN
[Raw transfer]




1BA_A_5(2GPP)
ERR3_HUMAN
[Raw transfer]




DES_E_5(1S9P)
ERR3_MOUSE
[Raw transfer]




DES_F_6(1S9P)
ERR3_MOUSE
[Raw transfer]




DES_G_7(1S9P)
ERR3_MOUSE
[Raw transfer]




5FB_A_2(3K6P)
ERR1_HUMAN
[Raw transfer]




5FB_A_2(3K6P)
ERR1_HUMAN
[Raw transfer]




CHD_E_5(1S9Q)
ERR3_MOUSE
[Raw transfer]




2 PsiBlast_PDB 91.6999%-120 - C5 -2ZAS 6.4 ERR3_HUMAN
3 PsiBlast_PDB 91.6699%-119 - C5 -2ZBS - ERR3_HUMAN -
40 HHSearch 91.38100%-119 - C5 -2E2R 7.1 ERR3_HUMAN
1 PsiBlast_PDB 91.3099%-118 - C5 -2E2R 7.1 ERR3_HUMAN
13 PsiBlast_PDB 90.84100%-120 - C5 -2P7G 6.8 ERR3_HUMAN
12 PsiBlast_PDB 90.80100%-119 - C5 -2P7A 4.0 ERR3_HUMAN
5 PsiBlast_PDB 90.73100%-118 - C5 -2GP7 - ERR3_HUMAN -
36 PsiBlast_CBE 90.57100%-118 - C5 -2EWP 9.0 ERR3_HUMAN
17 PsiBlast_PDB 90.41100%-119 - C5 -2EWP 8.5 ERR3_HUMAN
11 PsiBlast_PDB 90.37100%-122 - C5 -1TFC - ERR3_HUMAN -
7 PsiBlast_PDB 89.99100%-117 - C5 -2GPP 7.3 ERR3_HUMAN
4 PsiBlast_PDB 89.93100%-121 - C5 -1KV6 - ERR3_HUMAN -
6 PsiBlast_PDB 89.76100%-115 - C5 -2GPO - ERR3_HUMAN -
34 PsiBlast_CBE 89.73100%-119 - C5 -2EWP 8.9 ERR3_HUMAN
35 PsiBlast_CBE 88.81100%-116 - C5 -2EWP 9.0 ERR3_HUMAN
8 PsiBlast_PDB 88.63100%-120 - C5 -2GPU 8.7
30 PsiBlast_CBE 88.19100%-114 - C5 -1S9P 6.6
32 PsiBlast_CBE 87.27100%-113 - C5 -1S9P 6.5 ERR3_MOUSE
15 PsiBlast_PDB 87.17100%-113 - C5 -1S9Q 4.4 ERR3_MOUSE
33 PsiBlast_CBE 87.11100%-126 - C5 -2EWP 8.6
16 PsiBlast_PDB 85.54100%-111 - C5 -1S9P 6.3 ERR3_MOUSE
31 PsiBlast_CBE 85.15100%-112 - C5 -1S9P 6.3 ERR3_MOUSE
14 PsiBlast_PDB 84.10100%-109 - C5 -2P7Z 7.6 ERR3_HUMAN
28 PsiBlast_CBE 83.96100%-110 - C5 -1VJB 7.1 ERR3_HUMAN
10 PsiBlast_PDB 82.11100%-114 - C5 -1VJB 7.4 ERR3_HUMAN