@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : M_NR1I2_PXR: (2016-04-07 )
MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSGCELPEFLQASLLEDPATWSQIMKDRVPMKISLQLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDSHPFATPLMQELFSSTDG

Atome Classification :

(12 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SRL_A_3(3HVL)
NCOA1_HUMAN
[Raw transfer]




40U_A_3(4XHD)
NR1I2_HUMAN
[Raw transfer]




40U_B_6(4S0T)
NR1I2_HUMAN
[Raw transfer]




40U_A_5(4S0T)
NR1I2_HUMAN
[Raw transfer]




2Q4_A_2(4NY9)
NR1I2_HUMAN
[Raw transfer]




SRL_A_5(1NRL)
NR1I2_HUMAN
[Raw transfer]




CDZ_A_2(2QNV)
NR1I2_HUMAN
[Raw transfer]




444_F_6(2O9I)
NR1I2_HUMAN
[Raw transfer]




444_E_5(2O9I)
NR1I2_HUMAN
[Raw transfer]




3WF_A_2(4X1F)
?
[Raw transfer]




PNU_A_2(3R8D)
NR1I2_HUMAN
[Raw transfer]




RFP_B_2(1SKX)
NR1I2_HUMAN
[Raw transfer]




47 Fugue 97.1481%-140 * C1 *1SKX 5.2 NR1I2_HUMAN
5 PsiBlast_PDB 96.6176%-146 - C1 -2QNV 3.7 NR1I2_HUMAN
7 PsiBlast_PDB 95.5276%-133 - C1 -4X1F 5.7 ?
3 PsiBlast_PDB 95.4976%-136 - C1 -4XHD 7.1 NR1I2_HUMAN
8 PsiBlast_PDB 93.9378%-143 - C1 -4NY9 7.4 NR1I2_HUMAN
22 PsiBlast_CBE 93.6777%-126 - C1 -2O9I 7.3 NR1I2_HUMAN
2 PsiBlast_PDB 92.9576%-132 - C1 -3HVL 7.2 NCOA1_HUMAN (first)
21 PsiBlast_CBE 92.5076%-135 - C1 -4S0T 6.9 NR1I2_HUMAN
9 PsiBlast_PDB 92.3877%-128 - C1 -2O9I 5.7 NR1I2_HUMAN
6 PsiBlast_PDB 92.0376%-129 - C1 -3R8D 4.2 NR1I2_HUMAN
4 PsiBlast_PDB 91.0176%-134 - C1 -4S0T 6.9 NR1I2_HUMAN
25 HHSearch 77.4481%-143 - C1 -1NRL 5.9 NR1I2_HUMAN