@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : M_NR3A1_ESR1: (2016-04-07 )
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI

Atome Classification :

(219 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OHT_C_14(2JF9)

[Raw transfer]




OHT_B_11(2JF9)
ESR1_HUMAN
[Raw transfer]




1GV_A_5(4IWC)
ESR1_HUMAN
[Raw transfer]




AEJ_E_5(1XQC)
ESR1_HUMAN
[Raw transfer]




C3D_C_3(2OUZ)

[Raw transfer]




1GV_B_6(4IWC)

[Raw transfer]




EST_E_5(1G50)
ESR1_HUMAN
[Raw transfer]




AEJ_G_7(1XQC)
ESR1_HUMAN
[Raw transfer]




OHT_A_7(2JF9)
ESR1_HUMAN
[Raw transfer]




L4G_B_2(2AYR)

[Raw transfer]




Q97_B_12(3Q97)

[Raw transfer]




OHT_A_5(2BJ4)
ESR1_HUMAN
[Raw transfer]




ESE_B_6(4PPS)

[Raw transfer]




EED_B_6(2QGT)

[Raw transfer]




EST_B_3(2YJA)

[Raw transfer]




Q97_A_5(3Q97)
ESR1_HUMAN
[Raw transfer]




CM4_C_3(1YIM)

[Raw transfer]




ZTW_B_6(1GWQ)

[Raw transfer]




458_A_5(2B1V)
ESR1_HUMAN
[Raw transfer]




AEJ_F_6(1XQC)
ESR1_HUMAN
[Raw transfer]




JJ3_B_4(2JJ3)

[Raw transfer]




EST_A_5(3UUD)
ESR1_HUMAN
[Raw transfer]




17M_A_5(2B1Z)
ESR1_HUMAN
[Raw transfer]




ESE_A_5(4PPS)
ESR1_HUMAN
[Raw transfer]




EST_B_6(4PXM)

[Raw transfer]




EST_A_5(1GWR)
ESR1_HUMAN
[Raw transfer]




ESL_B_10(3Q95)

[Raw transfer]




AIU_C_3(1XP6)

[Raw transfer]




EST_E_5(1PCG)
ESR1_HUMAN
[Raw transfer]




T3O_A_5(2G44)
ESR1_HUMAN
[Raw transfer]




AIJ_C_3(1XP9)

[Raw transfer]




DRQ_B_6(2G5O)

[Raw transfer]




LLC_B_4(2R6Y)

[Raw transfer]




ESL_A_5(3Q95)
ESR1_HUMAN
[Raw transfer]




JJ3_B_4(2QE4)

[Raw transfer]




EST_A_5(4PXM)
ESR1_HUMAN
[Raw transfer]




EED_A_5(2QGT)
ESR1_HUMAN
[Raw transfer]




EST_C_8(1QKU)

[Raw transfer]




27L_B_6(4MGA)

[Raw transfer]




I0G_B_4(2I0G)

[Raw transfer]




369_A_3(3DT3)
ESR1_HUMAN
[Raw transfer]




KN2_A_5(2QA6)
ESR1_HUMAN
[Raw transfer]




4OH_A_7(3L03)
ESR1_HUMAN
[Raw transfer]




I0G_A_3(2I0G)
ESR2_HUMAN
[Raw transfer]




J3Z_B_6(3HM1)

[Raw transfer]




EST_G_7(1G50)

[Raw transfer]




EST_B_7(3UUD)

[Raw transfer]




EST_B_6(1GWR)

[Raw transfer]




AEJ_H_8(1XQC)

[Raw transfer]




EST_A_5(1QKU)
ESR1_HUMAN
[Raw transfer]




T3O_B_6(2G44)

[Raw transfer]




EST_F_6(1G50)
ESR1_HUMAN
[Raw transfer]




EST_A_3(1A52)
ESR1_HUMAN
[Raw transfer]




EST_B_7(1QKU)
ESR1_HUMAN
[Raw transfer]




DRQ_A_5(2G5O)
ESR1_HUMAN
[Raw transfer]




OHT_A_2(3ERT)

[Raw transfer]




WST_B_4(2POG)

[Raw transfer]




I0G_D_8(2I0J)

[Raw transfer]




27L_A_5(4MGA)
ESR1_HUMAN
[Raw transfer]




JJ3_A_3(2QE4)
ESR1_HUMAN
[Raw transfer]




I0G_B_6(2I0J)
ESR1_HUMAN
[Raw transfer]




J3Z_A_5(3HM1)
ESR1_HUMAN
[Raw transfer]




EST_B_4(1A52)

[Raw transfer]




689_A_5(1ZKY)
ESR1_HUMAN
[Raw transfer]




J2Z_B_6(3HLV)

[Raw transfer]




I0G_A_5(2I0J)
ESR1_HUMAN
[Raw transfer]




EST_B_10(4J24)
ESR2_HUMAN
[Raw transfer]




EST_A_3(2OCF)

[Raw transfer]




CM3_C_3(1YIN)

[Raw transfer]




EST_F_6(1PCG)

[Raw transfer]




WST_A_3(2POG)
ESR1_HUMAN
[Raw transfer]




AIT_C_3(1XPC)

[Raw transfer]




KN2_B_6(2QA6)

[Raw transfer]




EI1_A_5(2QAB)
ESR1_HUMAN
[Raw transfer]




459_B_6(2FAI)

[Raw transfer]




459_A_5(2FAI)
ESR1_HUMAN
[Raw transfer]




J2Z_A_5(3HLV)
ESR1_HUMAN
[Raw transfer]




EZT_B_6(2P15)

[Raw transfer]




IOG_A_2(2IOG)

[Raw transfer]




4OH_B_8(3L03)

[Raw transfer]




EST_B_3(1QKT)

[Raw transfer]




EST_B_6(3OLS)

[Raw transfer]




RAL_B_4(2QXS)

[Raw transfer]




0L8_B_6(4DMA)

[Raw transfer]




RAL_A_5(2JFA)
ESR1_HUMAN
[Raw transfer]




27K_A_5(4MG9)
ESR1_HUMAN
[Raw transfer]




ZTW_A_5(1GWQ)
ESR1_HUMAN
[Raw transfer]




EST_C_11(4J24)
ESR2_HUMAN
[Raw transfer]




244_E_5(1X7E)
ESR1_HUMAN
[Raw transfer]




EST_A_5(4J26)
ESR2_HUMAN
[Raw transfer]




EST_B_6(4J26)

[Raw transfer]




EI1_B_6(2QAB)

[Raw transfer]




EZT_A_5(2P15)
ESR1_HUMAN
[Raw transfer]




LLC_A_3(2R6Y)
ESR1_HUMAN
[Raw transfer]




AIH_C_3(1XP1)

[Raw transfer]




E3O_A_3(2J7Y)

[Raw transfer]




4NA_A_5(1YY4)
ESR2_HUMAN
[Raw transfer]




EST_D_12(4J24)

[Raw transfer]




LLB_A_3(2R6W)
ESR1_HUMAN
[Raw transfer]




RAL_A_3(2QXS)
ESR1_HUMAN
[Raw transfer]




EST_A_5(3OLS)
ESR2_HUMAN
[Raw transfer]




689_B_6(1ZKY)

[Raw transfer]




27J_A_5(4MG8)
ESR1_HUMAN
[Raw transfer]




244_F_6(1X7E)

[Raw transfer]




1GQ_B_6(4IUI)

[Raw transfer]




IOK_A_3(2IOK)
ESR1_HUMAN
[Raw transfer]




DC8_A_3(2Z4B)
ESR2_HUMAN
[Raw transfer]




4NA_B_6(1YY4)

[Raw transfer]




3AS_A_3(2QTU)
ESR2_HUMAN
[Raw transfer]




EEU_A_3(2YAT)

[Raw transfer]




HZ3_B_6(2QR9)

[Raw transfer]




1GR_B_6(4IV2)

[Raw transfer]




I0G_C_7(2I0J)
ESR1_HUMAN
[Raw transfer]




E4D_C_3(1SJ0)

[Raw transfer]




27K_B_7(4MG9)

[Raw transfer]




STL_A_5(4PP6)
ESR1_HUMAN
[Raw transfer]




EST_A_9(4J24)
ESR2_HUMAN
[Raw transfer]




GW5_E_5(1R5K)
ESR1_HUMAN
[Raw transfer]




DC8_A_3(2Q70)
ESR1_HUMAN
[Raw transfer]




1GT_B_6(4IVY)

[Raw transfer]




GEN_B_6(2QA8)

[Raw transfer]




85Z_A_3(5AK2)
ESR1_HUMAN
[Raw transfer]




244_F_6(1X78)

[Raw transfer]




1GJ_B_6(4IVW)

[Raw transfer]




GW5_F_6(1R5K)
ESR1_HUMAN
[Raw transfer]




DC8_B_4(2Z4B)

[Raw transfer]




LLB_B_4(2R6W)

[Raw transfer]




3AS_B_4(2QTU)

[Raw transfer]




27H_A_5(4MG7)
ESR1_HUMAN
[Raw transfer]




GEN_E_5(1X7R)

[Raw transfer]




244_E_5(1X78)
ESR2_HUMAN
[Raw transfer]




0L8_A_5(4DMA)
ESR1_HUMAN
[Raw transfer]




KN0_B_6(3OS8)
ESR1_HUMAN
[Raw transfer]




KN3_B_6(3OSA)
ESR1_HUMAN
[Raw transfer]




1GU_B_6(4IW6)

[Raw transfer]




GEN_F_6(1X7J)

[Raw transfer]




1HP_B_6(2QSE)

[Raw transfer]




1GJ_A_5(4IVW)
ESR1_HUMAN
[Raw transfer]




1GT_A_5(4IVY)
ESR1_HUMAN
[Raw transfer]




697_F_6(1X76)

[Raw transfer]




HZ3_A_5(2QR9)
ESR1_HUMAN
[Raw transfer]




KN3_A_5(4IW8)
ESR1_HUMAN
[Raw transfer]




DC8_B_4(2Q70)

[Raw transfer]




GW5_G_7(1R5K)

[Raw transfer]




15Q_B_6(4IWF)

[Raw transfer]




KN0_A_5(3OS8)
ESR1_HUMAN
[Raw transfer]




KN0_D_8(3OS8)

[Raw transfer]




27N_B_6(4MGD)

[Raw transfer]




GEN_A_5(2QA8)
ESR1_HUMAN
[Raw transfer]




27J_B_8(4MG8)

[Raw transfer]




ODE_B_6(2QH6)

[Raw transfer]




1GM_A_5(4IU7)
ESR1_HUMAN
[Raw transfer]




1GS_A_5(4IV4)
ESR1_HUMAN
[Raw transfer]




0D1_C_7(3UUC)
ESR1_HUMAN
[Raw transfer]




1GS_B_6(4IV4)

[Raw transfer]




1GM_B_6(4IU7)

[Raw transfer]




0D1_B_6(3UUC)
ESR1_HUMAN
[Raw transfer]




27M_A_5(4MGC)
ESR1_HUMAN
[Raw transfer]




KN3_B_6(4IW8)

[Raw transfer]




EES_A_5(2QGW)
ESR1_HUMAN
[Raw transfer]




OBH_A_5(4ZN9)
?
[Raw transfer]




OBH_B_6(4ZN9)
?
[Raw transfer]




KN1_B_6(2QZO)

[Raw transfer]




FBR_A_2(2GIU)

[Raw transfer]




85Z_B_4(5AK2)

[Raw transfer]




1GR_A_5(4IV2)
ESR1_HUMAN
[Raw transfer]




1HP_A_5(2QSE)
ESR1_HUMAN
[Raw transfer]




041_E_5(1X7B)
ESR2_HUMAN
[Raw transfer]




STL_B_6(4PP6)

[Raw transfer]




15Q_A_5(4IWF)
ESR1_HUMAN
[Raw transfer]




1GU_A_5(4IW6)
ESR1_HUMAN
[Raw transfer]




0D1_A_5(3UUC)
ESR1_HUMAN
[Raw transfer]




041_F_6(1X7B)

[Raw transfer]




KN0_C_7(3OS8)
ESR1_HUMAN
[Raw transfer]




YJD_B_6(2YJD)

[Raw transfer]




FSV_A_5(4PPP)
ESR1_HUMAN
[Raw transfer]




ODE_A_5(2QH6)
ESR1_HUMAN
[Raw transfer]




YJD_A_5(2YJD)
ESR2_HUMAN
[Raw transfer]




0D1_D_8(3UUC)

[Raw transfer]




EES_B_6(2QGW)

[Raw transfer]




A48_A_5(2Q6J)
ESR1_HUMAN
[Raw transfer]




0CZ_B_6(3UUA)

[Raw transfer]




27G_A_5(4MG6)
ESR1_HUMAN
[Raw transfer]




KN3_D_8(3OSA)

[Raw transfer]




IOK_B_4(2IOK)

[Raw transfer]




GEN_E_5(1X7J)
ESR2_HUMAN
[Raw transfer]




GEN_A_2(1QKM)

[Raw transfer]




27M_B_8(4MGC)

[Raw transfer]




196_E_5(1YYE)
ESR2_HUMAN
[Raw transfer]




WV7_B_6(3OMO)

[Raw transfer]




27H_B_7(4MG7)

[Raw transfer]




KN1_A_5(2QZO)
ESR1_HUMAN
[Raw transfer]




PIQ_B_6(2QXM)

[Raw transfer]




KN3_C_7(3OSA)
ESR1_HUMAN
[Raw transfer]




27N_A_5(4MGD)
ESR1_HUMAN
[Raw transfer]




W23_B_6(3OMQ)

[Raw transfer]




0CZ_A_5(3UUA)
ESR1_HUMAN
[Raw transfer]




PIQ_A_5(2QXM)
ESR1_HUMAN
[Raw transfer]




W23_A_5(3OMQ)
ESR2_HUMAN
[Raw transfer]




A48_B_6(2Q6J)

[Raw transfer]




FSV_B_6(4PPP)

[Raw transfer]




196_F_6(1YYE)

[Raw transfer]




WV7_A_5(3OMO)
ESR2_HUMAN
[Raw transfer]




KN1_D_12(3OS9)

[Raw transfer]




27G_B_6(4MG6)

[Raw transfer]




KN1_B_7(3OS9)
ESR1_HUMAN
[Raw transfer]




KN1_A_5(3OS9)
ESR1_HUMAN
[Raw transfer]




XDH_B_6(4MGB)

[Raw transfer]




W14_A_5(3OMP)
ESR2_HUMAN
[Raw transfer]




W14_B_6(3OMP)

[Raw transfer]




36J_A_5(4TUZ)
ESR1_HUMAN
[Raw transfer]




36M_A_5(4TV1)
ESR1_HUMAN
[Raw transfer]




XDH_A_5(4MGB)
ESR1_HUMAN
[Raw transfer]




KN1_C_9(3OS9)
ESR1_HUMAN
[Raw transfer]




36M_B_12(4TV1)

[Raw transfer]




27E_B_8(4MG5)

[Raw transfer]




27E_A_6(4MG5)
ESR1_HUMAN
[Raw transfer]




EDO_A_7(2J7X)

[Raw transfer]




36J_B_9(4TUZ)

[Raw transfer]




185 PsiBlast_CBE 93.6194%-145 * C4 *4MGC 5.7
15 PsiBlast_PDB 92.9195%-142 - C4 -2QSE 6.2 ESR1_HUMAN
127 PsiBlast_CBE 92.8796%-144 - C4 -1GWR 7.5
109 PsiBlast_CBE 92.8596%-142 - C4 -4IWC 7.7
143 PsiBlast_CBE 92.7496%-139 - C4 -1X7E 7.1 ESR1_HUMAN
113 PsiBlast_CBE 92.7496%-143 - C4 -4IW6 8.3
50 PsiBlast_CBE 92.7396%-138 - C4 -2YJA 7.9
35 PsiBlast_CBE 92.6495%-142 - C4 -2P15 11.3
166 PsiBlast_CBE 92.5594%-142 - C4 -2G5O 7.6
160 PsiBlast_CBE 92.4796%-148 - C4 -4PP6 5.2 ESR1_HUMAN
105 PsiBlast_CBE 92.4694%-144 - C4 -3Q97 7.2
147 PsiBlast_CBE 92.4195%-142 - C4 -4MGA 5.0 ESR1_HUMAN
165 PsiBlast_CBE 92.3694%-141 - C4 -3Q97 8.1 ESR1_HUMAN
30 PsiBlast_CBE 92.3495%-140 - C4 -2QGW 6.6
12 PsiBlast_PDB 92.3195%-145 - C4 -2QGW 6.2 ESR1_HUMAN
10 PsiBlast_PDB 92.3095%-145 - C4 -2QAB 6.6 ESR1_HUMAN
93 PsiBlast_CBE 92.2995%-140 - C4 -4MGD 7.0 ESR1_HUMAN
96 PsiBlast_CBE 92.2795%-141 - C4 -4MG7 7.6 ESR1_HUMAN
168 PsiBlast_CBE 92.2594%-148 - C4 -2G44 5.8
152 PsiBlast_CBE 92.2295%-138 - C4 -4MG5 6.0 ESR1_HUMAN
191 PsiBlast_CBE 92.2094%-148 - C4 -3HM1 7.3
110 PsiBlast_CBE 92.2296%-142 - C4 -4IWC 7.7 ESR1_HUMAN
27 PsiBlast_CBE 92.2095%-144 - C4 -2QSE 6.2
83 PsiBlast_CBE 92.1896%-136 - C4 -1GWQ 6.5
64 PsiBlast_CBE 92.1496%-136 - C4 -1QKU 7.3 ESR1_HUMAN
108 PsiBlast_CBE 92.1196%-141 - C4 -4IWF 6.0 ESR1_HUMAN
11 PsiBlast_PDB 92.0995%-146 - C4 -2QGT 8.3 ESR1_HUMAN
95 PsiBlast_CBE 92.0895%-144 - C4 -4MG9 4.5 ESR1_HUMAN
155 PsiBlast_CBE 92.0796%-144 - C4 -4PPS 6.9
142 PsiBlast_CBE 92.0696%-141 - C4 -1X7E 7.2
102 PsiBlast_CBE 92.0496%-145 - C4 -4DMA 6.8
60 PsiBlast_CBE 92.0395%-140 - C4 -3HLV 7.2
125 PsiBlast_CBE 92.0296%-136 - C4 -4IU7 7.8 ESR1_HUMAN
117 PsiBlast_CBE 91.9696%-142 - C4 -4IVW 8.6
115 PsiBlast_CBE 91.9596%-137 - C4 -4IVY 7.1
158 PsiBlast_CBE 91.9196%-153 - C4 -4PPP 5.8 ESR1_HUMAN
139 PsiBlast_CBE 91.9095%-139 - C4 -2AYR 10.4
128 PsiBlast_CBE 91.8796%-141 - C4 -1GWR 7.5 ESR1_HUMAN
63 PsiBlast_CBE 91.8396%-141 - C4 -1QKU 7.2 ESR1_HUMAN
121 PsiBlast_CBE 91.8096%-139 - C4 -4IV2 7.7
84 PsiBlast_CBE 91.8196%-136 - C4 -1GWQ 6.6 ESR1_HUMAN
7 PsiBlast_PDB 91.8095%-136 - C4 -2P15 11.5 ESR1_HUMAN
67 PsiBlast_CBE 91.7994%-142 - C4 -3Q95 7.4 ESR1_HUMAN
13 PsiBlast_PDB 91.7895%-146 - C4 -2QH6 6.6 ESR1_HUMAN
163 PsiBlast_CBE 91.7595%-145 - C4 -3UUD 7.6 ESR1_HUMAN
28 PsiBlast_CBE 91.7295%-143 - C4 -2QR9 4.9
189 PsiBlast_CBE 91.7094%-142 - C4 -4MG8 8.0
169 PsiBlast_CBE 91.6594%-139 - C4 -2G44 5.9 ESR1_HUMAN
150 PsiBlast_CBE 91.6495%-146 - C4 -4MG6 5.5 ESR1_HUMAN
101 PsiBlast_CBE 91.6595%-144 - C4 -3L03 7.4 ESR1_HUMAN
70 PsiBlast_CBE 91.6494%-144 - C4 -2QA8 7.4 ESR1_HUMAN
104 PsiBlast_CBE 91.6396%-141 - C4 -3UUA 5.9 ESR1_HUMAN