@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : M_NR3B2_ERR2: (2016-04-07 )
MSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGIALSTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYNCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLYAMPPNDIPEGDIKALTTLCELADRELVFLINWAKHIPGFPSLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLDLYRAILQLVRRYKKLKVEKEEFMILKALALANSDSMYIENLEAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLWTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OHT_D_4(1VJB)
ERR3_HUMAN
[Raw transfer]




TXF_C_8(2EWP)
ERR3_HUMAN
[Raw transfer]




OHT_A_2(2GPU)

[Raw transfer]




OHT_A_2(2P7Z)
ERR3_HUMAN
[Raw transfer]




TXF_E_10(2EWP)

[Raw transfer]




OHT_C_3(1VJB)
ERR3_HUMAN
[Raw transfer]




1OH_A_2(2ZAS)
ERR3_HUMAN
[Raw transfer]




TXF_A_6(2EWP)
ERR3_HUMAN
[Raw transfer]




TXF_D_9(2EWP)
ERR3_HUMAN
[Raw transfer]




2OH_A_3(2P7G)
ERR3_HUMAN
[Raw transfer]




047_B_4(2PJL)
ERR1_HUMAN
[Raw transfer]




DES_H_8(1S9P)

[Raw transfer]




2OH_A_2(2E2R)
ERR3_HUMAN
[Raw transfer]




TXF_B_7(2EWP)
ERR3_HUMAN
[Raw transfer]




2OH_A_2(2E2R)
ERR3_HUMAN
[Raw transfer]




047_A_3(2PJL)
ERR1_HUMAN
[Raw transfer]




43M_A_2(2P7A)
ERR3_HUMAN
[Raw transfer]




DES_E_5(1S9P)
ERR3_MOUSE
[Raw transfer]




1BA_A_5(2GPP)
ERR3_HUMAN
[Raw transfer]




DES_F_6(1S9P)
ERR3_MOUSE
[Raw transfer]




DES_G_7(1S9P)
ERR3_MOUSE
[Raw transfer]




5FB_A_2(3K6P)
ERR1_HUMAN
[Raw transfer]




CHD_E_5(1S9Q)
ERR3_MOUSE
[Raw transfer]




13 PsiBlast_PDB 92.0774%-136 - C5 -2P7G 5.6 ERR3_HUMAN
7 PsiBlast_PDB 91.9874%-134 - C5 -2GPP 6.8 ERR3_HUMAN
2 PsiBlast_PDB 91.7072%-137 - C5 -2ZAS 6.2 ERR3_HUMAN
12 PsiBlast_PDB 91.5174%-136 - C5 -2P7A 4.1 ERR3_HUMAN
34 PsiBlast_CBE 91.1373%-136 - C5 -2EWP 7.2 ERR3_HUMAN
45 HHSearch 90.8474%-138 - C5 -2E2R 5.8 ERR3_HUMAN
36 PsiBlast_CBE 90.5973%-138 - C5 -2EWP 7.6 ERR3_HUMAN
17 PsiBlast_PDB 90.2173%-139 - C5 -2EWP 6.7 ERR3_HUMAN
1 PsiBlast_PDB 90.1572%-137 - C5 -2E2R 5.8 ERR3_HUMAN
35 PsiBlast_CBE 89.6973%-136 - C5 -2EWP 7.8 ERR3_HUMAN
8 PsiBlast_PDB 89.1574%-139 - C5 -2GPU 8.7
30 PsiBlast_CBE 89.0674%-131 - C5 -1S9P 6.8
32 PsiBlast_CBE 88.2274%-131 - C5 -1S9P 6.4 ERR3_MOUSE
33 PsiBlast_CBE 88.0273%-144 - C5 -2EWP 7.1
15 PsiBlast_PDB 86.9274%-132 - C5 -1S9Q 4.4 ERR3_MOUSE
16 PsiBlast_PDB 86.4774%-129 - C5 -1S9P 6.6 ERR3_MOUSE
31 PsiBlast_CBE 85.2674%-128 - C5 -1S9P 6.5 ERR3_MOUSE
38 PsiBlast_CBE 84.8959%-130 - C5 -2PJL 7.9 ERR1_HUMAN
28 PsiBlast_CBE 84.8974%-128 - C5 -1VJB 7.3 ERR3_HUMAN
14 PsiBlast_PDB 84.7874%-128 - C5 -2P7Z 7.6 ERR3_HUMAN
39 PsiBlast_CBE 83.8759%-133 - C5 -2PJL 8.7 ERR1_HUMAN
20 PsiBlast_PDB 83.7260%-139 - C5 -3K6P 5.9 ERR1_HUMAN
10 PsiBlast_PDB 82.8274%-132 - C5 -1VJB 7.6 ERR3_HUMAN