@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : X_NR1A1_THAA: (2016-04-07 )
MDQNLSGLDCLSEPDEKRWPDGKRKRKNSQCMGKSGMSGDSLVSLPSAGYIPSYLDKDEPCVVCSDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYDGCCIIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEENRQRRRKEEMIKTLQQRPEPSSEEWELIRIVTEAHRSTNAQGSHWKQRRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELTCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLSGEMAVKREQLKNGGLGVVSDAIFDLGRSLAAFNLDDTEVALLQAVLLMSSDRTGLICTDKIEKCQETYLLAFEHYINHRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV

Atome Classification :

(16 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

T3_A_3(3UVV)
THA_CHICK
[Raw transfer]




PFA_C_3(1N46)
THB_HUMAN
[Raw transfer]




T3_X_8(1XZX)
THB_HUMAN
[Raw transfer]




T3_E_5(1BSX)
THB_HUMAN
[Raw transfer]




T3_F_6(1BSX)
THB_HUMAN
[Raw transfer]




T3_E_5(1BSX)
THB_HUMAN
[Raw transfer]




PFA_D_4(1N46)
THB_HUMAN
[Raw transfer]




IH5_A_2(1NAX)
THB_HUMAN
[Raw transfer]




4HY_A_2(1NQ1)
THB_HUMAN
[Raw transfer]




4HY_A_3(3D57)
THB_HUMAN
[Raw transfer]




4HY_A_4(2PIN)
THB_HUMAN
[Raw transfer]




G24_B_2(1Q4X)
THB_HUMAN
[Raw transfer]




T44_X_8(1Y0X)
THB_HUMAN
[Raw transfer]




4HY_A_3(1NQ2)
THB_HUMAN
[Raw transfer]




4HY_A_2(1NQ0)
THB_HUMAN
[Raw transfer]




4HY_B_6(2PIN)
THB_HUMAN
[Raw transfer]




1 PsiBlast_PDB 91.3395%-119 - C2 -3UVV 7.8 THA_CHICK
22 PsiBlast_CBE 88.7983%-132 - C2 -1N46 9.4 THB_HUMAN
3 PsiBlast_PDB 88.3383%-125 - C2 -1XZX 8.8 THB_HUMAN
5 PsiBlast_PDB 87.9482%-126 - C2 -1NQ0 8.6 THB_HUMAN
11 PsiBlast_PDB 87.8284%-127 - C2 -1Q4X 9.9 THB_HUMAN
47 Fugue 87.4486%-125 - C2 -1BSX 8.1 THB_HUMAN
12 PsiBlast_PDB 87.3784%-123 - C2 -1NAX 8.7 THB_HUMAN
13 PsiBlast_PDB 87.2784%-123 - C2 -2PIN 9.0 THB_HUMAN
7 PsiBlast_PDB 87.2682%-122 - C2 -1NQ1 8.6 THB_HUMAN
14 PsiBlast_PDB 87.2184%-124 - C2 -3D57 8.9 THB_HUMAN
4 PsiBlast_PDB 87.1183%-123 - C2 -1Y0X 8.6 THB_HUMAN
23 PsiBlast_CBE 87.0884%-120 - C2 -2PIN 8.6 THB_HUMAN
21 PsiBlast_CBE 86.8383%-126 - C2 -1BSX 8.2 THB_HUMAN
2 PsiBlast_PDB 86.8183%-125 - C2 -1BSX 8.1 THB_HUMAN
8 PsiBlast_PDB 86.6383%-118 - C2 -1N46 9.5 THB_HUMAN
6 PsiBlast_PDB 86.5282%-119 - C2 -1NQ2 7.5 THB_HUMAN