Study : X_NR1C1_PPARA (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C5_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C5_S1
Complex: GOL_B_4(2POB) / Model_141(2POB/B) = [3.1] Download478.4953.08MSTIMVDTNSELCILTPLDEDDLESPLSGEFLQDIVDIQDITQTIGDDGSTPFGASEHQFFGNSPGSIGSVSTDLTDTLSPASSPASITFPAASGSAEDAACKSLNLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLKLVYDRCERMCKIQKKNRNKCQYCRFEKCLNVGMSHNAIRFGRMPRSEKAKLKAEVLMCDQDVKDSQMADLLSLARLIYDAYLKNFNMNKVKARAILTGKASNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFTELDLNDQVTLLKYGVYEAMFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPIGDMMEPKFEFAMKFNALELDDSDLSLFVAALICCGDRPGLVNIPSIEKMQESIVHVLKLHLQSNHPDDSFLFPKLLQKMADLRQLVTEHAQLVQTIKKTETDAALHPLLQEIYRDMY
Complex: MSZ_A_3(4PWL) / Model_71(4PWL/A) = [3.2] Download1393.4444.32MSTIMVDTNSELCILTPLDEDDLESPLSGEFLQDIVDIQDITQTIGDDGSTPFGASEHQFFGNSPGSIGSVSTDLTDTLSPASSPASITFPAASGSAEDAACKSLNLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLKLVYDRCERMCKIQKKNRNKCQYCRFEKCLNVGMSHNAIRFGRMPRSEKAKLKAEVLMCDQDVKDSQMADLLSLARLIYDAYLKNFNMNKVKARAILTGKASNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFTELDLNDQVTLLKYGVYEAMFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPIGDMMEPKFEFAMKFNALELDDSDLSLFVAALICCGDRPGLVNIPSIEKMQESIVHVLKLHLQSNHPDDSFLFPKLLQKMADLRQLVTEHAQLVQTIKKTETDAALHPLLQEIYRDMY
Complex: GW9_B_4(3B0R) / Model_239(3B0R/B) = [3.2] Download956.2063.86MSTIMVDTNSELCILTPLDEDDLESPLSGEFLQDIVDIQDITQTIGDDGSTPFGASEHQFFGNSPGSIGSVSTDLTDTLSPASSPASITFPAASGSAEDAACKSLNLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLKLVYDRCERMCKIQKKNRNKCQYCRFEKCLNVGMSHNAIRFGRMPRSEKAKLKAEVLMCDQDVKDSQMADLLSLARLIYDAYLKNFNMNKVKARAILTGKASNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFTELDLNDQVTLLKYGVYEAMFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPIGDMMEPKFEFAMKFNALELDDSDLSLFVAALICCGDRPGLVNIPSIEKMQESIVHVLKLHLQSNHPDDSFLFPKLLQKMADLRQLVTEHAQLVQTIKKTETDAALHPLLQEIYRDMY
Complex: SRO_A_4(3ADV) / Model_85(3ADV/A) = [3.5] Download613.6842.09MSTIMVDTNSELCILTPLDEDDLESPLSGEFLQDIVDIQDITQTIGDDGSTPFGASEHQFFGNSPGSIGSVSTDLTDTLSPASSPASITFPAASGSAEDAACKSLNLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLKLVYDRCERMCKIQKKNRNKCQYCRFEKCLNVGMSHNAIRFGRMPRSEKAKLKAEVLMCDQDVKDSQMADLLSLARLIYDAYLKNFNMNKVKARAILTGKASNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFTELDLNDQVTLLKYGVYEAMFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPIGDMMEPKFEFAMKFNALELDDSDLSLFVAALICCGDRPGLVNIPSIEKMQESIVHVLKLHLQSNHPDDSFLFPKLLQKMADLRQLVTEHAQLVQTIKKTETDAALHPLLQEIYRDMY
Complex: XPT_B_4(3PO9) / Model_67(3PO9/B) = [3.5] Download457.3445.18MSTIMVDTNSELCILTPLDEDDLESPLSGEFLQDIVDIQDITQTIGDDGSTPFGASEHQFFGNSPGSIGSVSTDLTDTLSPASSPASITFPAASGSAEDAACKSLNLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLKLVYDRCERMCKIQKKNRNKCQYCRFEKCLNVGMSHNAIRFGRMPRSEKAKLKAEVLMCDQDVKDSQMADLLSLARLIYDAYLKNFNMNKVKARAILTGKASNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFTELDLNDQVTLLKYGVYEAMFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPIGDMMEPKFEFAMKFNALELDDSDLSLFVAALICCGDRPGLVNIPSIEKMQESIVHVLKLHLQSNHPDDSFLFPKLLQKMADLRQLVTEHAQLVQTIKKTETDAALHPLLQEIYRDMY
Consensus
[pKd Mean = 3.30]
-779
(s=354)
49
(s=8)
MSTIMVDTNSELCILTPLDEDDLESPLSGEFLQDIVDIQDITQTIGDDGSTPFGASEHQFFGNSPGSIGSVSTDLTDTLSPASSPASITFPAASGSAEDAACKSLNLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLKLVYDRCERMCKIQKKNRNKCQYCRFEKCLNVGMSHNAIRFGRMPRSEKAKLKAEVLMCDQDVKDSQMADLLSLARLIYDAYLKNFNMNKVKARAILTGKASNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFTELDLNDQVTLLKYGVYEAMFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPIGDMMEPKFEFAMKFNALELDDSDLSLFVAALICCGDRPGLVNIPSIEKMQESIVHVLKLHLQSNHPDDSFLFPKLLQKMADLRQLVTEHAQLVQTIKKTETDAALHPLLQEIYRDMY