@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : X_NR1C3_PPARG: (2016-04-07 )
MVDTEMPFWSNLNFGMNSMDMSALEDHCQPYDIKPFTTVDFSSINSHYDDILDEKTFLCRNDQSPIDYKYDLKLQECQSSIKLEPPSPPYFSDKPQCSKAFEDTPNSFIAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYERCDLNCRIHKKSRNKCQFCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADQRVLAKHLYDSYVKSFPLTKAKAPGHPDGQSHRQNSRGYTRHELADDGGGSDQGAVREPRAEQGGGDSNLPALSVALRGGVREITEFAKNIPGFVSLDLNDQVTLLKYGVHEIIFTMLASLMNKDGVLVAEGQGFMTREFLKSLRKPFSDFMEPKFEFAIRFNSLELDDSDLAIFVAVIILSGDRPGLLNVKPIEDIQDSLLQALELQLKLNHPDSAQLFAKLLQKMTDLRQVVTEHVQLLQLIKKTEADMCLHPLLQEIYKDLY

Atome Classification :

(187 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2PQ_A_3(3GBK)
PPARG_HUMAN
[Raw transfer]




AZ2_C_3(1I7I)
PPARG_HUMAN
[Raw transfer]




9HO_A_3(2VSR)
PPARG_HUMAN
[Raw transfer]




DRH_A_3(2I4Z)
PPARG_HUMAN
[Raw transfer]




UNT_A_3(3IA6)
PPARG_HUMAN
[Raw transfer]




DRJ_C_3(2I4J)
PPARG_HUMAN
[Raw transfer]




486_A_3(3QT0)
PPARG_HUMAN
[Raw transfer]




5BC_A_3(3NOA)
PPARG_HUMAN
[Raw transfer]




24L_A_3(3V9Y)
PPARG_HUMAN
[Raw transfer]




4HD_A_3(2VV1)
PPARG_HUMAN
[Raw transfer]




5BC_B_4(3NOA)
PPARG_HUMAN
[Raw transfer]




208_A_3(2GTK)
PPARG_HUMAN
[Raw transfer]




ZAA_A_2(3BC5)
PPARG_HUMAN
[Raw transfer]




VCA_A_7(2B50)
PPARD_HUMAN
[Raw transfer]




072_C_7(4PRG)
PPARG_HUMAN
[Raw transfer]




L41_B_4(3D5F)
PPARD_HUMAN
[Raw transfer]




14R_X_3(4HEE)
PPARG_HUMAN
[Raw transfer]




EHA_C_3(2F4B)
PPARG_HUMAN
[Raw transfer]




DRH_C_3(2I4P)
PPARG_HUMAN
[Raw transfer]




072_A_5(4PRG)
PPARG_HUMAN
[Raw transfer]




5HE_A_3(2VV2)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZVT)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET3)
PPARG_HUMAN
[Raw transfer]




DRD_A_3(2HWR)
PPARG_HUMAN
[Raw transfer]




XCX_A_3(3R8I)
PPARG_HUMAN
[Raw transfer]




JJA_A_3(3WMH)
PPARG_HUMAN
[Raw transfer]




538_D_6(3KMG)
PPARG_HUMAN
[Raw transfer]




F22_A_3(2VV0)
PPARG_HUMAN
[Raw transfer]




TLS_A_3(3VN2)
PPARG_HUMAN
[Raw transfer]




HIG_A_3(3R8A)
PPARG_HUMAN
[Raw transfer]




JJA_B_4(3WMH)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3B3K)
PPARG_HUMAN
[Raw transfer]




AZ2_D_4(1I7I)
PPARG_HUMAN
[Raw transfer]




EK1_A_3(3VSO)
PPARG_HUMAN
[Raw transfer]




L92_A_3(2Q8S)
PPARG_HUMAN
[Raw transfer]




EK8_A_3(3VSP)
PPARG_HUMAN
[Raw transfer]




3OZ_A_2(3OZ0)
PPARD_HUMAN
[Raw transfer]




331_N_14(1Y0S)
PPARD_HUMAN
[Raw transfer]




VCA_F_6(2AWH)
PPARD_HUMAN
[Raw transfer]




WY1_A_4(4BCR)
PPARA_HUMAN
[Raw transfer]




DKD_A_3(3HO0)
PPARG_HUMAN
[Raw transfer]




GRR_A_3(3CDS)
PPARG_HUMAN
[Raw transfer]




GW4_A_3(2POB)
PPARG_HUMAN
[Raw transfer]




3EQ_A_3(3PEQ)
PPARD_HUMAN
[Raw transfer]




3EQ_B_10(3PEQ)
PPARD_HUMAN
[Raw transfer]




072_B_6(4PRG)
PPARG_HUMAN
[Raw transfer]




VCA_F_6(2BAW)
PPARD_HUMAN
[Raw transfer]




IL2_B_4(3SP9)
PPARD_HUMAN
[Raw transfer]




M7S_A_3(3AN3)
PPARG_HUMAN
[Raw transfer]




M0T_A_3(3S9S)
PPARG_HUMAN
[Raw transfer]




VCA_B_8(2B50)
PPARD_HUMAN
[Raw transfer]




CTM_A_3(3FEJ)
PPARG_HUMAN
[Raw transfer]




Y1N_A_3(4CI5)
PPARG_HUMAN
[Raw transfer]




RO7_A_3(3G8I)
PPARA_HUMAN
[Raw transfer]




LNA_B_7(3CWD)
PPARG_HUMAN
[Raw transfer]




3EA_C_3(2ATH)
PPARG_HUMAN
[Raw transfer]




RO7_A_3(3G9E)
PPARG_HUMAN
[Raw transfer]




VCA_E_5(2AWH)
PPARD_HUMAN
[Raw transfer]




538_A_5(3KMG)
PPARG_HUMAN
[Raw transfer]




3JX_A_3(4R2U)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZK1)
PPARG_HUMAN
[Raw transfer]




ZZH_A_3(3HOD)
PPARG_HUMAN
[Raw transfer]




C01_C_3(1ZEO)
PPARG_HUMAN
[Raw transfer]




IL2_A_3(3SP9)
PPARD_HUMAN
[Raw transfer]




J35_A_3(3VJH)
PPARG_HUMAN
[Raw transfer]




UNT_B_4(3IA6)
PPARG_HUMAN
[Raw transfer]




4R8_A_3(2VV3)
PPARG_HUMAN
[Raw transfer]




PTG_A_4(2ZK2)
PPARG_HUMAN
[Raw transfer]




072_D_8(4PRG)
PPARG_HUMAN
[Raw transfer]




OCX_A_3(2ZK3)
PPARG_HUMAN
[Raw transfer]




3EA_D_4(2ATH)
PPARG_HUMAN
[Raw transfer]




331_O_15(1Y0S)
PPARD_HUMAN
[Raw transfer]




ET1_B_7(3ET2)
PPARD_HUMAN
[Raw transfer]




GW0_A_2(3TKM)
PPARD_HUMAN
[Raw transfer]




LNA_A_5(3CWD)
PPARG_HUMAN
[Raw transfer]




GOL_B_4(2POB)
PPARG_HUMAN
[Raw transfer]




T9T_A_3(3WJ5)
PPARG_HUMAN
[Raw transfer]




M7R_A_3(3AN4)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADS)
PPARG_HUMAN
[Raw transfer]




5OX_A_3(3X1H)
PPARG_HUMAN
[Raw transfer]




YRG_A_3(3CDP)
PPARG_HUMAN
[Raw transfer]




LRG_B_4(4L98)
PPARG_HUMAN
[Raw transfer]




AXY_A_3(4JL4)
PPARG_HUMAN
[Raw transfer]




RO0_C_3(2FVJ)
PPARG_HUMAN
[Raw transfer]




C08_B_4(2ZK6)
PPARG_HUMAN
[Raw transfer]




3K2_A_3(4R6S)
PPARG_HUMAN
[Raw transfer]




OCR_A_3(2ZK4)
PPARG_HUMAN
[Raw transfer]




21L_A_3(3V9V)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(4L98)
PPARG_HUMAN
[Raw transfer]




WY1_B_6(4BCR)
PPARA_HUMAN
[Raw transfer]




NSI_D_4(2HFP)
PPARG_HUMAN
[Raw transfer]




LRG_A_2(4L96)
PPARG_HUMAN
[Raw transfer]




ET1_B_6(3ET1)
PPARA_HUMAN
[Raw transfer]




3JX_D_4(4R2U)
PPARG_HUMAN
[Raw transfer]




S44_A_3(2ZNO)
PPARG_HUMAN
[Raw transfer]




6OC_A_3(2VV4)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADX)
PPARG_HUMAN
[Raw transfer]




DRY_A_3(2HWQ)
PPARG_HUMAN
[Raw transfer]




MYI_A_4(3ADU)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET2)
PPARD_HUMAN
[Raw transfer]




66B_A_3(3X1I)
PPARG_HUMAN
[Raw transfer]




K55_B_6(2ZNP)
PPARD_HUMAN
[Raw transfer]




TBY_B_4(3WJ4)
PPARG_HUMAN
[Raw transfer]




243_B_4(2VST)
PPARG_HUMAN
[Raw transfer]




L41_A_3(3D5F)
PPARD_HUMAN
[Raw transfer]




HIG_B_4(3R8A)
PPARG_HUMAN
[Raw transfer]




K55_A_4(2ZNP)
PPARD_HUMAN
[Raw transfer]




0W3_A_3(4FGY)
PPARG_HUMAN
[Raw transfer]




TBY_A_3(3WJ4)
PPARG_HUMAN
[Raw transfer]




240_B_4(2Q59)
PPARG_HUMAN
[Raw transfer]




17L_A_3(3V9T)
PPARG_HUMAN
[Raw transfer]




RRG_A_4(4E4K)
PPARG_HUMAN
[Raw transfer]




243_A_3(2VST)
PPARG_HUMAN
[Raw transfer]




XPT_B_4(3PO9)
PPARG_HUMAN
[Raw transfer]




MYR_B_6(3SZ1)
PPARG_HUMAN
[Raw transfer]




XPT_A_3(3PO9)
PPARG_HUMAN
[Raw transfer]




DY6_B_5(3DY6)
PPARD_HUMAN
[Raw transfer]




CEK_A_3(3LMP)
PPARG_HUMAN
[Raw transfer]




T9T_B_4(3WJ5)
PPARG_HUMAN
[Raw transfer]




YFE_A_3(2YFE)
PPARG_HUMAN
[Raw transfer]




EPA_B_4(3GWX)
PPARD_HUMAN
[Raw transfer]




D30_D_6(3H0A)
PPARG_HUMAN
[Raw transfer]




401_A_4(2ZNQ)
PPARD_HUMAN
[Raw transfer]




AJA_B_7(2OM9)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3D6D)
PPARG_HUMAN
[Raw transfer]




YFD_A_3(4A4V)
PPARG_HUMAN
[Raw transfer]




Y1N_B_4(4CI5)
PPARG_HUMAN
[Raw transfer]




KRC_A_3(3B1M)
PPARG_HUMAN
[Raw transfer]




YFE_B_4(2YFE)
PPARG_HUMAN
[Raw transfer]




CTI_A_3(4Y29)
?
[Raw transfer]




C08_A_3(2ZK6)
PPARG_HUMAN
[Raw transfer]




3K2_B_4(4R6S)
PPARG_HUMAN
[Raw transfer]




SP0_C_3(2G0G)
PPARG_HUMAN
[Raw transfer]




S44_B_4(2ZNO)
PPARG_HUMAN
[Raw transfer]




AJA_A_5(2OM9)
PPARG_HUMAN
[Raw transfer]




OCX_B_4(2ZK3)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZVT)
PPARG_HUMAN
[Raw transfer]




SF1_B_3(2Q61)
PPARG_HUMAN
[Raw transfer]




AJA_C_9(2OM9)
PPARG_HUMAN
[Raw transfer]




SF1_A_4(2Q61)
PPARG_HUMAN
[Raw transfer]




401_B_6(2ZNQ)
PPARD_HUMAN
[Raw transfer]




DY6_A_4(3DY6)
PPARD_HUMAN
[Raw transfer]




4HD_B_4(2VV1)
PPARG_HUMAN
[Raw transfer]




SF2_A_3(2Q6R)
PPARG_HUMAN
[Raw transfer]




ZXG_A_3(3PBA)
PPARG_HUMAN
[Raw transfer]




MLO_A_3(3R5N)
PPARG_HUMAN
[Raw transfer]




SF2_B_4(2Q6R)
PPARG_HUMAN
[Raw transfer]




AJA_D_12(2OM9)
PPARG_HUMAN
[Raw transfer]




YFD_B_4(4A4V)
PPARG_HUMAN
[Raw transfer]




GW9_D_12(3E00)
PPARG_HUMAN
[Raw transfer]




NRO_B_4(2ZK5)
PPARG_HUMAN
[Raw transfer]




5OX_B_4(3X1H)
PPARG_HUMAN
[Raw transfer]




NZA_B_3(2Q5S)
PPARG_HUMAN
[Raw transfer]




241_A_3(2Q5P)
PPARG_HUMAN
[Raw transfer]




1FA_B_4(2Q5G)
PPARD_HUMAN
[Raw transfer]




FCM_A_3(4F9M)
PPARG_HUMAN
[Raw transfer]




NZA_A_4(2Q5S)
PPARG_HUMAN
[Raw transfer]




6OB_B_4(2VV4)
PPARG_HUMAN
[Raw transfer]




F22_B_4(2VV0)
PPARG_HUMAN
[Raw transfer]




OCR_A_4(3ADW)
PPARG_HUMAN
[Raw transfer]




OCR_B_4(2ZK4)
PPARG_HUMAN
[Raw transfer]




9HO_B_5(2VSR)
PPARG_HUMAN
[Raw transfer]




GW9_B_4(3B0R)
PPARG_HUMAN
[Raw transfer]




5HE_B_5(2VV2)
PPARG_HUMAN
[Raw transfer]




Z12_A_3(3FUR)
PPARG_HUMAN
[Raw transfer]




Z27_A_3(3K8S)
PPARG_HUMAN
[Raw transfer]




YFB_B_4(4A4W)
PPARG_HUMAN
[Raw transfer]




PLB_D_12(3DZU)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADS)
PPARG_HUMAN
[Raw transfer]




XDH_A_3(3OSI)
PPARG_HUMAN
[Raw transfer]




MYI_B_7(3ADU)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZK1)
PPARG_HUMAN
[Raw transfer]




PLB_B_3(2Q6S)
PPARG_HUMAN
[Raw transfer]




DIF_A_2(4OJ4)
PPARG_HUMAN
[Raw transfer]




Z27_B_5(3K8S)
PPARG_HUMAN
[Raw transfer]




SP3_C_3(2G0H)
PPARG_HUMAN
[Raw transfer]




XDI_A_3(3OSW)
PPARG_HUMAN
[Raw transfer]




SP3_D_4(2G0H)
PPARG_HUMAN
[Raw transfer]




HID_A_4(3ADT)
PPARG_HUMAN
[Raw transfer]




66B_B_4(3X1I)
PPARG_HUMAN
[Raw transfer]




OCR_B_5(3ADW)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADX)
PPARG_HUMAN
[Raw transfer]




KNA_A_4(3SZ1)
PPARG_HUMAN
[Raw transfer]




9HO_A_4(2VSR)
PPARG_HUMAN
[Raw transfer]




SRO_A_4(3ADV)
PPARG_HUMAN
[Raw transfer]




MSZ_A_3(4PWL)
PPARG_HUMAN
[Raw transfer]




2 PsiBlast_PDB 88.1476%-109 - C5 -3E00 3.6 PPARG_HUMAN
1 PsiBlast_PDB 87.2676%-109 - C5 -3DZU 6.3 PPARG_HUMAN
38 PsiBlast_CBE 80.3871%-112 - C5 -3VJH 4.5 PPARG_HUMAN
45 PsiBlast_CBE 79.5271%-107 - C5 -3AN4 6.6 PPARG_HUMAN
157 PsiBlast_CBE 79.3870%-110 - C5 -2GTK 5.7 PPARG_HUMAN
152 PsiBlast_CBE 79.3770%-113 - C5 -3FEJ 5.4 PPARG_HUMAN
11 PsiBlast_PDB 79.3171%-110 - C5 -4A4V 4.1 PPARG_HUMAN
111 PsiBlast_CBE 79.2871%-113 - C5 -2Q5S 5.7 PPARG_HUMAN
133 PsiBlast_CBE 79.2170%-109 - C5 -3V9Y 7.1 PPARG_HUMAN
19 PsiBlast_PDB 78.9571%-107 - C5 -3PBA 5.5 PPARG_HUMAN
134 PsiBlast_CBE 78.8570%-111 - C5 -3V9V 6.9 PPARG_HUMAN
64 PsiBlast_CBE 78.7871%-112 - C5 -3OSW 5.6 PPARG_HUMAN
169 PsiBlast_CBE 78.6770%-107 - C5 -3ET3 4.4 PPARG_HUMAN
88 PsiBlast_CBE 78.6371%-110 - C5 -2VST 4.6 PPARG_HUMAN
112 PsiBlast_CBE 78.5271%-109 - C5 -2Q5P 6.6 PPARG_HUMAN
65 PsiBlast_CBE 78.4371%-111 - C5 -3OSI 5.3 PPARG_HUMAN
37 PsiBlast_CBE 78.4071%-107 - C5 -3VSO 5.8 PPARG_HUMAN
100 PsiBlast_CBE 78.3271%-107 - C5 -2XKW - PPARG_HUMAN -
181 PsiBlast_CBE 78.2870%-110 - C5 -3U9Q - PPARG_HUMAN -
84 PsiBlast_CBE 78.1271%-108 - C5 -2VV1 4.9 PPARG_HUMAN
59 PsiBlast_CBE 78.1071%-106 - C5 -2ZK1 3.4 PPARG_HUMAN
162 PsiBlast_CBE 78.0970%-106 - C5 -2F4B 7.3 PPARG_HUMAN
6 PsiBlast_PDB 78.0871%-110 - C5 -3ADV 3.9 PPARG_HUMAN
96 PsiBlast_CBE 78.0471%-115 - C5 -2OM9 4.3 PPARG_HUMAN
180 PsiBlast_CBE 78.0270%-111 - C5 -4Y29 4.9 ?
60 PsiBlast_CBE 78.0171%-107 - C5 -2I4Z 5.4 PPARG_HUMAN
151 PsiBlast_CBE 77.9970%-112 - C5 -3G9E 5.5 PPARG_HUMAN
90 PsiBlast_CBE 77.9971%-109 - C5 -2VSR 4.6 PPARG_HUMAN
86 PsiBlast_CBE 77.9971%-111 - C5 -2VV0 5.0 PPARG_HUMAN
155 PsiBlast_CBE 77.9770%-111 - C5 -2HWR 7.9 PPARG_HUMAN
46 PsiBlast_CBE 77.9071%-107 - C5 -3AN3 6.0 PPARG_HUMAN
10 PsiBlast_PDB 77.8971%-109 - C5 -2YFE 4.3 PPARG_HUMAN
135 PsiBlast_CBE 77.8770%-110 - C5 -3V9T 6.3 PPARG_HUMAN
4 PsiBlast_PDB 77.8771%-111 - C5 -3ADT 3.2 PPARG_HUMAN
161 PsiBlast_CBE 77.8070%-112 - C5 -2FVJ 9.1 PPARG_HUMAN
94 PsiBlast_CBE 77.7571%-113 - C5 -2OM9 5.3 PPARG_HUMAN
137 PsiBlast_CBE 77.6870%-110 - C5 -3B1M 5.8 PPARG_HUMAN
7 PsiBlast_PDB 77.6871%-106 - C5 -3ADW 3.8 PPARG_HUMAN
50 PsiBlast_CBE 77.6471%-106 - C5 -2ZK6 6.9 PPARG_HUMAN
43 PsiBlast_CBE 77.6071%-109 - C5 -3CDP 4.0 PPARG_HUMAN
119 PsiBlast_CBE 77.5370%-110 - C5 -3KMG 7.6 PPARG_HUMAN
118 PsiBlast_CBE 77.5370%-107 - C5 -4CI5 6.9 PPARG_HUMAN
80 PsiBlast_CBE 77.5271%-113 - C5 -2VV4 3.5 PPARG_HUMAN
54 PsiBlast_CBE 77.4671%-103 - C5 -2ZK4 3.9 PPARG_HUMAN
18 PsiBlast_PDB 77.4571%-105 - C5 -2ZVT 4.6 PPARG_HUMAN
62 PsiBlast_CBE 77.4371%-107 - C5 -2I4J 5.7 PPARG_HUMAN
5 PsiBlast_PDB 77.4371%-112 - C5 -3ADU 3.4 PPARG_HUMAN
69 PsiBlast_CBE 77.4271%-110 - C5 -1I7I 4.8 PPARG_HUMAN
8 PsiBlast_PDB 77.3971%-105 - C5 -3ADX 5.7 PPARG_HUMAN
3 PsiBlast_PDB 77.3971%-108 - C5 -3ADS 5.4 PPARG_HUMAN
79 PsiBlast_CBE 77.3671%-110 - C5 -3X1H 4.0 PPARG_HUMAN
36 PsiBlast_CBE 77.3071%-106 - C5 -3VSP 6.0 PPARG_HUMAN
35 PsiBlast_CBE 77.3071%-107 - C5 -3WMH 7.4 PPARG_HUMAN
57 PsiBlast_CBE 77.2971%-104 - C5 -2ZK2 4.6 PPARG_HUMAN
132 PsiBlast_CBE 77.1970%-110 - C5 -4F9M 6.0 PPARG_HUMAN
121 PsiBlast_CBE 77.1870%-107 - C5 -3K8S 7.6 PPARG_HUMAN
109 PsiBlast_CBE 77.1871%-113 - C5 -2Q61 5.4 PPARG_HUMAN
150 PsiBlast_CBE 77.1670%-104 - C5 -3GBK 7.9 PPARG_HUMAN
164 PsiBlast_CBE 77.1270%-107 - C5 -2ATH 6.8 PPARG_HUMAN
124 PsiBlast_CBE 77.0870%-111 - C5 -3FUR 6.9 PPARG_HUMAN
156 PsiBlast_CBE 77.0470%-108 - C5 -2HWQ 6.0 PPARG_HUMAN