@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : X_NR3C2_MCR: (2016-04-07 )
GNEIADSTVSLVKFIKPDPDAIFSSTCFGDTVSSDPAFSIPIKQESCKNTCSSALFKGSQSANPFPFMDGSYFAFMDDKDYYSLSGILGPPVSSFGDGFEGNGFSNQSLNVAIKQETEDSSFYPENNMPSSAIVGVNSCGQSFHYRIGAQGTISLSRPLNRDQSFQNLSSFPPMSSLVESWKTQSELAQNTLSSRRNDGFPVPGYIPENMSSTTLRSMSTGPSRPSKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGKCSRQHSYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGVHEEHPQQPLQQTPTASPKEDTTLTSSSKEPSANSNSLVPLISAVSPAITLSAAVILENIEPEIVYAGYDNTQPDTAENLLSSLNQLAGKQMVQVVKWAKVIPGFRNLPLEDQITLIQYSWMCLSSFALSWRSYKHASSQFLYFAPDLIFNEERMRQSAMYDLCQGMQQISLEFSRLQLTFEEYTLMKVLLLLSTVPKDGLKCQAAFEEMRVNYIKELRKVLLKSPHNSGQSWQRYFQLTKLLDSMQDLVGDLLEFCFYTFRESQALKVEFPAMLVEIISDQLPKVESGIAKPLYFHRK

Atome Classification :

(164 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

C0R_C_3(2A3I)

[Raw transfer]




1CA_E_5(2ABI)
MCR_HUMAN
[Raw transfer]




AS4_D_4(2AA2)

[Raw transfer]




1CA_D_4(1Y9R)

[Raw transfer]




1CA_C_3(2AA7)

[Raw transfer]




1CA_D_4(2ABI)
MCR_HUMAN
[Raw transfer]




1CA_C_3(1Y9R)
MCR_HUMAN
[Raw transfer]




DEX_A_5(3GN8)
?
[Raw transfer]




DEX_B_6(3GN8)
?
[Raw transfer]




DEX_A_4(3MNE)

[Raw transfer]




DEX_A_4(3MNP)

[Raw transfer]




1CA_F_6(2ABI)

[Raw transfer]




DEX_I_9(1M2Z)

[Raw transfer]




DEX_A_4(3MNP)

[Raw transfer]




1CA_B_7(3RY9)
?
[Raw transfer]




DEX_H_8(1M2Z)
GCR_HUMAN
[Raw transfer]




DEX_L_12(1P93)

[Raw transfer]




DEX_A_4(3MNO)

[Raw transfer]




1CA_A_4(3RY9)
?
[Raw transfer]




DAY_A_3(3BQD)

[Raw transfer]




DEX_J_10(1P93)
GCR_HUMAN
[Raw transfer]




DEX_K_11(1P93)
GCR_HUMAN
[Raw transfer]




JZN_A_7(3K23)
GCR_HUMAN
[Raw transfer]




STR_F_6(1YA3)

[Raw transfer]




LSJ_A_3(4LSJ)

[Raw transfer]




A2K_B_5(4APU)

[Raw transfer]




STR_D_4(1YA3)
MCR_HUMAN
[Raw transfer]




STR_A_3(2AA5)
MCR_HUMAN
[Raw transfer]




SNL_A_4(2AB2)
MCR_HUMAN
[Raw transfer]




WFG_A_2(3WFG)

[Raw transfer]




TES_A_2(2YLO)
?
[Raw transfer]




DHT_A_3(3L3Z)

[Raw transfer]




HFN_A_2(4PF3)

[Raw transfer]




TES_A_2(4HLW)

[Raw transfer]




STR_A_3(4FN9)
?
[Raw transfer]




R18_C_3(1XOW)

[Raw transfer]




STR_B_9(4FN9)
?
[Raw transfer]




AS0_A_3(4A2J)
PRGR_HUMAN
[Raw transfer]




LD1_A_2(3VHV)

[Raw transfer]




2S0_A_3(4OAR)

[Raw transfer]




DHT_A_3(2PKL)

[Raw transfer]




DEX_I_9(1P93)
GCR_HUMAN
[Raw transfer]




TES_A_2(3ZQT)

[Raw transfer]




17H_A_3(2AMB)

[Raw transfer]




AS0_B_5(4A2J)

[Raw transfer]




STR_A_3(2AA6)
MCR_HUMAN
[Raw transfer]




WOW_B_5(3KBA)

[Raw transfer]




DHT_A_4(1T73)

[Raw transfer]




R18_A_3(1E3K)
PRGR_HUMAN
[Raw transfer]




DHT_B_2(1I38)

[Raw transfer]




SNL_A_2(3VHU)

[Raw transfer]




DHT_C_3(1XJ7)

[Raw transfer]




NOG_A_3(3D90)
PRGR_HUMAN
[Raw transfer]




STR_B_4(2AA6)

[Raw transfer]




DHT_B_2(1I37)

[Raw transfer]




DHT_C_3(1T5Z)

[Raw transfer]




DHT_A_3(3L3X)

[Raw transfer]




DHT_A_3(2PIO)

[Raw transfer]




DHT_A_2(2PIX)

[Raw transfer]




DHT_A_3(1T7R)

[Raw transfer]




DHT_A_3(2AMA)

[Raw transfer]




DHT_A_3(1T79)

[Raw transfer]




486_B_8(3H52)
GCR_HUMAN
[Raw transfer]




R18_B_4(1E3K)

[Raw transfer]




TES_A_3(2YHD)

[Raw transfer]




STR_B_4(2AA5)

[Raw transfer]




29M_A_5(4MDD)
GCR_HUMAN
[Raw transfer]




DHT_A_3(2PIV)

[Raw transfer]




DHT_A_3(2PIT)

[Raw transfer]




R18_B_2(1XQ3)
?
[Raw transfer]




DHT_A_3(1T7F)

[Raw transfer]




TES_A_3(2Q7L)

[Raw transfer]




STR_E_5(1YA3)
MCR_HUMAN
[Raw transfer]




AS0_A_3(2OVH)

[Raw transfer]




NDR_C_3(1SQN)
PRGR_HUMAN
[Raw transfer]




WFF_A_2(3WFF)

[Raw transfer]




MOF_A_4(1SR7)
PRGR_HUMAN
[Raw transfer]




NDR_C_3(1SQN)
PRGR_HUMAN
[Raw transfer]




DHT_A_4(1T74)

[Raw transfer]




STR_A_3(1A28)
PRGR_HUMAN
[Raw transfer]




MOF_A_3(4P6W)

[Raw transfer]




DHT_A_5(1T76)

[Raw transfer]




DHT_A_2(1T7T)

[Raw transfer]




DHT_C_3(1T65)

[Raw transfer]




NOG_B_4(3D90)

[Raw transfer]




TES_A_3(2YLQ)

[Raw transfer]




DHT_A_3(2QPY)

[Raw transfer]




DHT_A_3(2Z4J)

[Raw transfer]




486_A_7(3H52)
GCR_HUMAN
[Raw transfer]




DHT_A_3(2PIR)

[Raw transfer]




MOF_A_6(4E2J)
?
[Raw transfer]




SNL_B_5(2AB2)

[Raw transfer]




TES_A_3(2AM9)

[Raw transfer]




DHT_A_3(4OFR)

[Raw transfer]




T98_E_5(1ZUC)

[Raw transfer]




NDR_D_4(1SQN)

[Raw transfer]




DHT_A_4(1T7M)

[Raw transfer]




AS0_C_3(2OVM)

[Raw transfer]




TES_A_4(2Q7J)

[Raw transfer]




R18_A_2(1E3G)

[Raw transfer]




GW6_B_6(3CLD)

[Raw transfer]




ENM_A_3(2PNU)

[Raw transfer]




ORC_B_8(3ZRB)

[Raw transfer]




MOF_B_7(4E2J)
?
[Raw transfer]




MOF_B_5(1SR7)

[Raw transfer]




DHT_C_3(1T63)

[Raw transfer]




ORB_A_3(3ZRA)
PRGR_HUMAN
[Raw transfer]




486_B_2(1NHZ)

[Raw transfer]




STR_B_4(1A28)

[Raw transfer]




ZK5_A_2(1GS4)

[Raw transfer]




JZN_B_8(3K23)
GCR_HUMAN
[Raw transfer]




GW6_A_5(3CLD)
GCR_HUMAN
[Raw transfer]




CA4_A_2(2OZ7)

[Raw transfer]




T98_D_4(1ZUC)
PRGR_HUMAN
[Raw transfer]




OR8_A_3(4APU)
PRGR_HUMAN
[Raw transfer]




486_D_11(3H52)

[Raw transfer]




JZN_C_9(3K23)

[Raw transfer]




NN7_A_4(4CSJ)

[Raw transfer]




OR8_B_10(3ZR7)

[Raw transfer]




B68_A_2(3B68)

[Raw transfer]




FHM_B_2(2AX7)

[Raw transfer]




JAD_A_2(4QL8)

[Raw transfer]




FHM_B_2(2AXA)

[Raw transfer]




486_C_10(3H52)
GCR_HUMAN
[Raw transfer]




OR8_A_3(3ZR7)
PRGR_HUMAN
[Raw transfer]




FHM_B_2(2AX8)

[Raw transfer]




HFT_B_2(2AX6)

[Raw transfer]




B67_A_2(3B67)

[Raw transfer]




30X_A_3(3G8O)
PRGR_HUMAN
[Raw transfer]




HFT_A_3(4OJ9)

[Raw transfer]




ORB_B_5(3ZRA)

[Raw transfer]




198_C_3(1Z95)

[Raw transfer]




OR8_A_3(3ZRB)
PRGR_HUMAN
[Raw transfer]




30X_B_4(3G8O)

[Raw transfer]




BHM_A_2(2AX9)

[Raw transfer]




RLL_A_2(3RLL)

[Raw transfer]




JZS_A_5(3K22)
GCR_HUMAN
[Raw transfer]




GKK_B_9(3HQ5)

[Raw transfer]




LG7_B_2(2IHQ)

[Raw transfer]




198_A_4(4OKX)

[Raw transfer]




3B6_A_2(3B65)

[Raw transfer]




198_A_2(4OJB)

[Raw transfer]




GKK_A_7(3HQ5)
PRGR_HUMAN
[Raw transfer]




RLJ_A_2(3RLJ)
?
[Raw transfer]




866_A_5(3E7C)
GCR_HUMAN
[Raw transfer]




8NH_A_2(2NW4)

[Raw transfer]




198_A_3(4OK1)

[Raw transfer]




LGB_A_2(3G0W)

[Raw transfer]




198_A_3(4OLM)

[Raw transfer]




198_A_4(4OKB)

[Raw transfer]




B66_A_2(3B66)

[Raw transfer]




B5R_A_2(3B5R)

[Raw transfer]




3E0_A_2(4U4K)
?
[Raw transfer]




866_B_7(3E7C)

[Raw transfer]




198_A_3(4OKT)

[Raw transfer]




198_A_3(4OKW)

[Raw transfer]




PK0_A_3(3V49)

[Raw transfer]




LGD_A_2(2HVC)

[Raw transfer]




PK1_A_3(3V4A)

[Raw transfer]




LD2_A_3(3VHV)

[Raw transfer]




RB1_A_4(2PIQ)
?
[Raw transfer]




EDO_A_3(4CSJ)

[Raw transfer]




K10_L_7(2PIP)
?
[Raw transfer]




056_A_5(2YLP)

[Raw transfer]




T3_A_3(2PIW)

[Raw transfer]




4HY_A_3(2PIU)

[Raw transfer]




15 PsiBlast_PDB 93.8382%-123 - C4 -3VHV 8.7
3 PsiBlast_PDB 93.7981%-125 - C4 -2AA7 8.6
1 PsiBlast_PDB 93.1781%-125 - C4 -2AA2 8.7
4 PsiBlast_PDB 92.8980%-126 - C4 -3VHU 9.5
5 PsiBlast_PDB 92.8580%-121 - C4 -2AA6 8.2 MCR_HUMAN
2 PsiBlast_PDB 92.7881%-120 - C4 -2AA5 8.0 MCR_HUMAN
24 PsiBlast_CBE 92.7380%-122 - C4 -2AA6 8.2
26 PsiBlast_CBE 92.7284%-127 - C4 -2ABI 8.6 MCR_HUMAN
10 PsiBlast_PDB 92.7280%-116 - C4 -4PF3 9.2
28 PsiBlast_CBE 92.6784%-131 - C4 -1YA3 7.7 MCR_HUMAN
9 PsiBlast_PDB 92.5180%-117 - C4 -3WFG 7.8
22 PsiBlast_CBE 92.4380%-123 - C4 -2AB2 7.6
27 PsiBlast_CBE 92.2784%-129 - C4 -1YA3 6.8
13 PsiBlast_PDB 92.2484%-128 - C4 -1YA3 7.8 MCR_HUMAN
8 PsiBlast_PDB 92.0380%-114 - C4 -3WFF 7.2
16 PsiBlast_PDB 92.0284%-119 - C4 -2A3I 8.9
21 PsiBlast_CBE 91.9281%-122 - C4 -2AA5 8.0
12 PsiBlast_PDB 91.7484%-127 - C4 -1Y9R 7.8 MCR_HUMAN
11 PsiBlast_PDB 91.7484%-136 - C4 -2ABI 8.7 MCR_HUMAN
25 PsiBlast_CBE 91.6284%-129 - C4 -2ABI 8.1
7 PsiBlast_PDB 91.5880%-118 - C4 -2AB2 7.2 MCR_HUMAN
29 PsiBlast_CBE 89.8484%-121 - C4 -1Y9R 8.6
35 PsiBlast_CBE 87.4573%-121 - C4 -4FN9 7.4 ?
18 PsiBlast_PDB 86.8373%-118 - C4 -4FN9 7.8 ?
19 PsiBlast_PDB 86.4669%-121 - C4 -3RY9 8.7 ?
36 PsiBlast_CBE 86.4369%-123 - C4 -3RY9 8.7 ?
37 PsiBlast_CBE 86.2262%-126 - C4 -3GN8 7.6 ?
55 PsiBlast_CBE 86.2055%-124 - C4 -3MNP 5.6
52 PsiBlast_CBE 85.8055%-125 - C4 -3MNE 5.0
222 HHSearch 85.3957%-125 - C4 -3MNP 5.6
20 PsiBlast_PDB 85.2562%-123 - C4 -3GN8 7.3 ?
53 PsiBlast_CBE 85.1655%-122 - C4 -3MNO 5.4
54 PsiBlast_CBE 85.0454%-127 - C4 -4P6W 7.6
38 PsiBlast_CBE 84.8462%-123 - C4 -4E2J 8.1 ?
61 PsiBlast_CBE 84.5954%-127 - C4 -3CLD 7.3 GCR_HUMAN
63 PsiBlast_CBE 84.4154%-126 - C4 -3E7C 3.5 GCR_HUMAN
39 PsiBlast_CBE 84.3962%-123 - C4 -4E2J 8.3 ?
59 PsiBlast_CBE 84.1054%-125 - C4 -3K22 7.8 GCR_HUMAN
65 PsiBlast_CBE 84.0754%-123 - C4 -1M2Z 7.5 GCR_HUMAN
62 PsiBlast_CBE 83.9154%-127 - C4 -3E7C 4.7
64 PsiBlast_CBE 83.6554%-119 - C4 -1M2Z 8.0
57 PsiBlast_CBE 83.6254%-124 - C4 -3K23 9.7 GCR_HUMAN
58 PsiBlast_CBE 83.4854%-116 - C4 -3K23 6.3 GCR_HUMAN
60 PsiBlast_CBE 83.0054%-128 - C4 -3CLD 7.4
97 PsiBlast_CBE 82.8755%-119 - C4 -3KBA 7.3
67 PsiBlast_CBE 82.8454%-122 - C4 -3BQD 8.6
71 PsiBlast_CBE 82.7755%-117 - C4 -1SR7 9.1
72 PsiBlast_CBE 82.7655%-120 - C4 -1SR7 9.4 PRGR_HUMAN
46 PsiBlast_CBE 82.6653%-119 - C4 -4CSJ 9.4
91 PsiBlast_CBE 82.6255%-118 - C4 -3HQ5 8.9
47 PsiBlast_CBE 82.5553%-125 - C4 -1P93 6.4
77 PsiBlast_CBE 82.5355%-122 - C4 -3ZRB 6.4
80 PsiBlast_CBE 82.4055%-120 - C4 -3ZRA 6.7 PRGR_HUMAN
108 PsiBlast_CBE 82.1252%-120 - C4 -2PNU 9.7
76 PsiBlast_CBE 82.0955%-120 - C4 -4A2J 5.1 PRGR_HUMAN
56 PsiBlast_CBE 82.0754%-119 - C4 -3K23 10.6
48 PsiBlast_CBE 82.0453%-128 - C4 -1P93 6.5 GCR_HUMAN
70 PsiBlast_CBE 82.0355%-117 - C4 -1ZUC 7.3 PRGR_HUMAN
82 PsiBlast_CBE 81.9655%-120 - C4 -3ZR7 6.5 PRGR_HUMAN
74 PsiBlast_CBE 81.9255%-118 - C4 -4APU 6.0 PRGR_HUMAN
96 PsiBlast_CBE 81.9155%-118 - C4 -1A28 7.4 PRGR_HUMAN
66 PsiBlast_CBE 81.8854%-129 - C4 -4LSJ 7.8
88 PsiBlast_CBE 81.8455%-119 - C4 -1E3K 6.5 PRGR_HUMAN
95 PsiBlast_CBE 81.7755%-119 - C4 -1A28 7.5
73 PsiBlast_CBE 81.6855%-117 - C4 -4APU 11.2
75 PsiBlast_CBE 81.5155%-120 - C4 -4A2J 4.1
110 PsiBlast_CBE 81.4452%-116 - C4 -2AMA 7.0
160 PsiBlast_CBE