@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Z_NR1C2_PPARb1: (2016-04-07 )
RSCKVQKKSRNKCQFCRFQKCLMLGMSHDAIRYGRMPEAEKRKLVAGLLAGERGSQNSNESDLKTLAKRVNNAYLKNLNMTKKKARNILTGKTSASTPFVIHDMDSLVQAENGLVWNQVIHGAPPNNEIGVHVFYRCQCTTVETVRELNEFSKSIPGFIDLFLNDQVTLLKYGVHEAIFAMLPSLMNKDGLLVANGRGFVTREFLRSLRKPFSEIMEPKFEFAVKFNALELDDSDLALFVAAIILCGDRPGLMNVHQVEKIQDSILQALNQHLQLNHPDGRFIFPRLLQKLADLRQLVTENAQLVQKIKKTESETSLHPLLQEIYRDLY

Atome Classification :

(167 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IL2_A_3(3SP9)
PPARD_HUMAN
[Raw transfer]




IL2_B_4(3SP9)
PPARD_HUMAN
[Raw transfer]




S44_A_2(2ZNN)
PPARA_HUMAN
[Raw transfer]




VCA_B_8(2B50)
PPARD_HUMAN
[Raw transfer]




3EQ_B_10(3PEQ)
PPARD_HUMAN
[Raw transfer]




IL2_A_3(3SP6)
PPARA_HUMAN
[Raw transfer]




3EQ_A_3(3PEQ)
PPARD_HUMAN
[Raw transfer]




VCA_A_7(2B50)
PPARD_HUMAN
[Raw transfer]




L41_B_4(3D5F)
PPARD_HUMAN
[Raw transfer]




2PQ_A_3(3GBK)
PPARG_HUMAN
[Raw transfer]




VCA_F_6(2AWH)
PPARD_HUMAN
[Raw transfer]




L41_A_3(3D5F)
PPARD_HUMAN
[Raw transfer]




5BC_B_4(3NOA)
PPARG_HUMAN
[Raw transfer]




5BC_A_3(3NOA)
PPARG_HUMAN
[Raw transfer]




VCA_E_5(2AWH)
PPARD_HUMAN
[Raw transfer]




Y1N_A_2(4CI4)
PPARA_HUMAN
[Raw transfer]




24L_A_3(3V9Y)
PPARG_HUMAN
[Raw transfer]




VCA_F_6(2BAW)
PPARD_HUMAN
[Raw transfer]




DRD_A_3(2HWR)
PPARG_HUMAN
[Raw transfer]




K55_B_6(2ZNP)
PPARD_HUMAN
[Raw transfer]




K55_A_4(2ZNP)
PPARD_HUMAN
[Raw transfer]




735_C_3(2P54)
PPARA_HUMAN
[Raw transfer]




401_A_4(2ZNQ)
PPARD_HUMAN
[Raw transfer]




GW0_A_2(3TKM)
PPARD_HUMAN
[Raw transfer]




401_B_6(2ZNQ)
PPARD_HUMAN
[Raw transfer]




3EA_D_4(2ATH)
PPARG_HUMAN
[Raw transfer]




S44_A_3(2ZNO)
PPARG_HUMAN
[Raw transfer]




3OZ_A_2(3OZ0)
PPARD_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




UNT_A_3(3IA6)
PPARG_HUMAN
[Raw transfer]




4HD_A_3(2VV1)
PPARG_HUMAN
[Raw transfer]




EK1_A_3(3VSO)
PPARG_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




331_N_14(1Y0S)
PPARD_HUMAN
[Raw transfer]




DRJ_C_3(2I4J)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET3)
PPARG_HUMAN
[Raw transfer]




ET1_B_7(3ET2)
PPARD_HUMAN
[Raw transfer]




RO7_A_3(3G9E)
PPARG_HUMAN
[Raw transfer]




AZ2_C_3(1I7I)
PPARG_HUMAN
[Raw transfer]




208_A_3(2GTK)
PPARG_HUMAN
[Raw transfer]




331_O_15(1Y0S)
PPARD_HUMAN
[Raw transfer]




5HE_A_3(2VV2)
PPARG_HUMAN
[Raw transfer]




9HO_A_3(2VSR)
PPARG_HUMAN
[Raw transfer]




ET1_A_5(3ET1)
PPARA_HUMAN
[Raw transfer]




CTM_A_3(3FEJ)
PPARG_HUMAN
[Raw transfer]




M7S_A_3(3AN3)
PPARG_HUMAN
[Raw transfer]




RO7_A_3(3G8I)
PPARA_HUMAN
[Raw transfer]




XCX_A_3(3R8I)
PPARG_HUMAN
[Raw transfer]




L92_A_3(2Q8S)
PPARG_HUMAN
[Raw transfer]




AZ2_D_4(1I7I)
PPARG_HUMAN
[Raw transfer]




CTM_A_3(3FEI)
PPARA_HUMAN
[Raw transfer]




3EA_C_3(2ATH)
PPARG_HUMAN
[Raw transfer]




UNT_B_4(3IA6)
PPARG_HUMAN
[Raw transfer]




C01_C_3(1ZEO)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3B3K)
PPARG_HUMAN
[Raw transfer]




5OX_A_3(3X1H)
PPARG_HUMAN
[Raw transfer]




Y1N_A_3(4CI5)
PPARG_HUMAN
[Raw transfer]




ET1_B_6(3ET1)
PPARA_HUMAN
[Raw transfer]




DRH_A_3(2I4Z)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET2)
PPARD_HUMAN
[Raw transfer]




M7R_A_3(3AN4)
PPARG_HUMAN
[Raw transfer]




GRR_A_3(3CDS)
PPARG_HUMAN
[Raw transfer]




EHA_C_3(2F4B)
PPARG_HUMAN
[Raw transfer]




EK8_A_3(3VSP)
PPARG_HUMAN
[Raw transfer]




ZAA_A_2(3BC5)
PPARG_HUMAN
[Raw transfer]




DY6_B_5(3DY6)
PPARD_HUMAN
[Raw transfer]




ZZH_A_3(3HOD)
PPARG_HUMAN
[Raw transfer]




WY1_A_4(4BCR)
PPARA_HUMAN
[Raw transfer]




TLS_A_3(3VN2)
PPARG_HUMAN
[Raw transfer]




DRY_A_3(2HWQ)
PPARG_HUMAN
[Raw transfer]




F22_A_3(2VV0)
PPARG_HUMAN
[Raw transfer]




240_B_4(2Q59)
PPARG_HUMAN
[Raw transfer]




DY6_A_4(3DY6)
PPARD_HUMAN
[Raw transfer]




1FA_A_3(2Q5G)
PPARD_HUMAN
[Raw transfer]




J35_A_3(3VJH)
PPARG_HUMAN
[Raw transfer]




YRG_A_3(3CDP)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADS)
PPARG_HUMAN
[Raw transfer]




WLM_B_6(2XYJ)
PPARD_HUMAN
[Raw transfer]




IMN_A_4(3ADX)
PPARG_HUMAN
[Raw transfer]




538_D_6(3KMG)
PPARG_HUMAN
[Raw transfer]




DKD_A_3(3HO0)
PPARG_HUMAN
[Raw transfer]




RRG_A_4(4E4K)
PPARG_HUMAN
[Raw transfer]




14R_X_3(4HEE)
PPARG_HUMAN
[Raw transfer]




MYI_A_4(3ADU)
PPARG_HUMAN
[Raw transfer]




LRG_A_2(4L96)
PPARG_HUMAN
[Raw transfer]




4R8_A_3(2VV3)
PPARG_HUMAN
[Raw transfer]




LNA_A_5(3CWD)
PPARG_HUMAN
[Raw transfer]




6OC_A_3(2VV4)
PPARG_HUMAN
[Raw transfer]




WLM_A_3(2XYJ)
PPARD_HUMAN
[Raw transfer]




08S_A_3(2XYW)
PPARD_HUMAN
[Raw transfer]




3JX_D_4(4R2U)
PPARG_HUMAN
[Raw transfer]




NSI_D_4(2HFP)
PPARG_HUMAN
[Raw transfer]




GW4_A_3(2POB)
PPARG_HUMAN
[Raw transfer]




OCX_A_3(2ZK3)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(4L98)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZVT)
PPARG_HUMAN
[Raw transfer]




LRG_B_4(4L98)
PPARG_HUMAN
[Raw transfer]




08S_B_5(2XYW)
PPARD_HUMAN
[Raw transfer]




3JX_A_3(4R2U)
PPARG_HUMAN
[Raw transfer]




17L_A_3(3V9T)
PPARG_HUMAN
[Raw transfer]




538_A_5(3KMG)
PPARG_HUMAN
[Raw transfer]




21L_A_3(3V9V)
PPARG_HUMAN
[Raw transfer]




M0T_A_3(3S9S)
PPARG_HUMAN
[Raw transfer]




486_A_3(3QT0)
PPARG_HUMAN
[Raw transfer]




LNA_B_7(3CWD)
PPARG_HUMAN
[Raw transfer]




Z00_A_3(2XYX)
PPARD_HUMAN
[Raw transfer]




LRG_A_3(3D6D)
PPARG_HUMAN
[Raw transfer]




Z00_B_5(2XYX)
PPARD_HUMAN
[Raw transfer]




GW9_B_4(3B0R)
PPARG_HUMAN
[Raw transfer]




66B_A_3(3X1I)
PPARG_HUMAN
[Raw transfer]




HIG_A_3(3R8A)
PPARG_HUMAN
[Raw transfer]




3K2_A_3(4R6S)
PPARG_HUMAN
[Raw transfer]




CEK_A_3(3LMP)
PPARG_HUMAN
[Raw transfer]




MLO_A_3(3R5N)
PPARG_HUMAN
[Raw transfer]




YFE_A_3(2YFE)
PPARG_HUMAN
[Raw transfer]




243_B_4(2VST)
PPARG_HUMAN
[Raw transfer]




SF2_A_3(2Q6R)
PPARG_HUMAN
[Raw transfer]




RO0_C_3(2FVJ)
PPARG_HUMAN
[Raw transfer]




1FA_B_4(2Q5G)
PPARD_HUMAN
[Raw transfer]




SF2_B_4(2Q6R)
PPARG_HUMAN
[Raw transfer]




T9T_B_4(3WJ5)
PPARG_HUMAN
[Raw transfer]




HIG_B_4(3R8A)
PPARG_HUMAN
[Raw transfer]




SF1_A_4(2Q61)
PPARG_HUMAN
[Raw transfer]




4HD_B_4(2VV1)
PPARG_HUMAN
[Raw transfer]




XPT_B_4(3PO9)
PPARG_HUMAN
[Raw transfer]




T9T_A_3(3WJ5)
PPARG_HUMAN
[Raw transfer]




SP0_C_3(2G0G)
PPARG_HUMAN
[Raw transfer]




EPA_B_4(3GWX)
PPARD_HUMAN
[Raw transfer]




ZXG_A_3(3PBA)
PPARG_HUMAN
[Raw transfer]




FCM_A_3(4F9M)
PPARG_HUMAN
[Raw transfer]




SP3_D_4(2G0H)
PPARG_HUMAN
[Raw transfer]




243_A_3(2VST)
PPARG_HUMAN
[Raw transfer]




YFD_A_3(4A4V)
PPARG_HUMAN
[Raw transfer]




TBY_A_3(3WJ4)
PPARG_HUMAN
[Raw transfer]




KRC_A_3(3B1M)
PPARG_HUMAN
[Raw transfer]




NRO_B_4(2ZK5)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZK1)
PPARG_HUMAN
[Raw transfer]




NZA_A_4(2Q5S)
PPARG_HUMAN
[Raw transfer]




SP3_C_3(2G0H)
PPARG_HUMAN
[Raw transfer]




PTG_A_4(2ZK2)
PPARG_HUMAN
[Raw transfer]




TBY_B_4(3WJ4)
PPARG_HUMAN
[Raw transfer]




471_K_11(1KKQ)
PPARA_HUMAN
[Raw transfer]




5OX_B_4(3X1H)
PPARG_HUMAN
[Raw transfer]




Z12_A_3(3FUR)
PPARG_HUMAN
[Raw transfer]




LU2_B_5(3SZ1)
PPARG_HUMAN
[Raw transfer]




MYI_B_7(3ADU)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADX)
PPARG_HUMAN
[Raw transfer]




471_L_12(1KKQ)
PPARA_HUMAN
[Raw transfer]




471_J_10(1KKQ)
PPARA_HUMAN
[Raw transfer]




YFD_B_4(4A4V)
PPARG_HUMAN
[Raw transfer]




NRO_A_3(2ZK5)
PPARG_HUMAN
[Raw transfer]




WY1_B_8(4BCR)
PPARA_HUMAN
[Raw transfer]




PTG_B_4(2ZK1)
PPARG_HUMAN
[Raw transfer]




GW9_D_12(3E00)
PPARG_HUMAN
[Raw transfer]




Z27_B_5(3K8S)
PPARG_HUMAN
[Raw transfer]




F22_B_4(2VV0)
PPARG_HUMAN
[Raw transfer]




471_I_9(1KKQ)
PPARA_HUMAN
[Raw transfer]




XDI_A_3(3OSW)
PPARG_HUMAN
[Raw transfer]




OCX_B_4(2ZK3)
PPARG_HUMAN
[Raw transfer]




MSZ_A_3(4PWL)
PPARG_HUMAN
[Raw transfer]




XDH_A_3(3OSI)
PPARG_HUMAN
[Raw transfer]




MYI_A_3(3ADW)
PPARG_HUMAN
[Raw transfer]




HID_A_4(3ADT)
PPARG_HUMAN
[Raw transfer]




SRO_A_4(3ADV)
PPARG_HUMAN
[Raw transfer]




KNA_A_4(3SZ1)
PPARG_HUMAN
[Raw transfer]




5HE_B_5(2VV2)
PPARG_HUMAN
[Raw transfer]




36 PsiBlast_CBE 92.1477%-126 - C6 -2B50 7.2 PPARD_HUMAN
14 PsiBlast_PDB 91.8078%-131 - C6 -3PEQ 9.5 PPARD_HUMAN
32 PsiBlast_CBE 91.7078%-134 - C6 -3DY6 7.4 PPARD_HUMAN
13 PsiBlast_PDB 91.6478%-136 - C6 -3DY6 7.4 PPARD_HUMAN
15 PsiBlast_PDB 91.2978%-127 - C6 -3TKM 8.6 PPARD_HUMAN
38 PsiBlast_CBE 91.2178%-129 - C6 -3D5F 8.6 PPARD_HUMAN
18 PsiBlast_PDB 91.1678%-122 - C6 -3GZ9 - PPARD_HUMAN -
24 PsiBlast_CBE 91.1176%-123 - C6 -2ZNQ 9.2 PPARD_HUMAN
16 PsiBlast_PDB 90.8778%-126 - C6 -1Y0S 8.9 PPARD_HUMAN
30 PsiBlast_CBE 90.7578%-132 - C6 -3PEQ 9.1 PPARD_HUMAN
17 PsiBlast_PDB 90.7578%-129 - C6 -2AWH 6.9 PPARD_HUMAN
10 PsiBlast_PDB 90.6476%-128 - C6 -3SP9 8.0 PPARD_HUMAN
29 PsiBlast_CBE 90.5576%-126 - C6 -3SP9 7.6 PPARD_HUMAN
1 PsiBlast_PDB 90.3575%-128 - C6 -3ET2 6.3 PPARD_HUMAN
19 PsiBlast_PDB 90.3177%-128 - C6 -2B50 6.9 PPARD_HUMAN
37 PsiBlast_CBE 90.2078%-127 - C6 -3D5F 7.9 PPARD_HUMAN
6 PsiBlast_PDB 89.7776%-127 - C6 -2ZNQ 8.6 PPARD_HUMAN
28 PsiBlast_CBE 89.7577%-125 - C6 -2XYJ 7.7 PPARD_HUMAN
35 PsiBlast_CBE 89.6378%-132 - C6 -2AWH 6.5 PPARD_HUMAN
39 PsiBlast_CBE 89.2378%-133 - C6 -2BAW 6.4 PPARD_HUMAN
25 PsiBlast_CBE 89.1476%-121 - C6 -2ZNP 9.4 PPARD_HUMAN
9 PsiBlast_PDB 88.8977%-127 - C6 -2XYX 7.4 PPARD_HUMAN
5 PsiBlast_PDB 88.7776%-125 - C6 -2ZNP 7.9 PPARD_HUMAN
34 PsiBlast_CBE 88.7578%-129 - C6 -1Y0S 8.9 PPARD_HUMAN
21 PsiBlast_CBE 88.6975%-125 - C6 -3ET2 5.8 PPARD_HUMAN
7 PsiBlast_PDB 88.4777%-121 - C6 -2XYJ 7.7 PPARD_HUMAN
3 PsiBlast_PDB 88.1975%-129 - C6 -3OZ0 9.6 PPARD_HUMAN
27 PsiBlast_CBE 88.1377%-127 - C6 -2XYW 9.6 PPARD_HUMAN
8 PsiBlast_PDB 87.8877%-127 - C6 -2XYW 9.5 PPARD_HUMAN
43 PsiBlast_CBE 87.7168%-131 - C6 -4CI4 6.8 PPARA_HUMAN
40 PsiBlast_CBE 87.0460%-109 - C6 -3E00 4.1 PPARG_HUMAN
63 PsiBlast_CBE 86.9569%-127 - C6 -3FEI 7.4 PPARA_HUMAN
31 PsiBlast_CBE 86.3578%-123 - C6 -3GWX 5.8 PPARD_HUMAN
42 PsiBlast_CBE 86.2668%-118 - C6 -3SP6 7.2 PPARA_HUMAN
136 PsiBlast_CBE 85.7160%-123 - C6 -3SZ1 3.0 PPARG_HUMAN
157 PsiBlast_CBE 85.6260%-125 - C6 -2GTK 6.5 PPARG_HUMAN
26 PsiBlast_CBE 85.5077%-121 - C6 -2XYX 7.6 PPARD_HUMAN
193 PsiBlast_CBE 85.2060%-128 - C6 -3V9T 8.2 PPARG_HUMAN
195 PsiBlast_CBE 85.1460%-127 - C6 -3B1M 7.5 PPARG_HUMAN
169 PsiBlast_CBE 85.0960%-122 - C6 -3KMG 8.6 PPARG_HUMAN
114 PsiBlast_CBE 85.0860%-121 - C6 -2YFE 4.9 PPARG_HUMAN
86 PsiBlast_CBE 85.0060%-122 - C6 -1ZEO 5.4 PPARG_HUMAN
192 PsiBlast_CBE 84.9660%-126 - C6 -3V9V 6.5 PPARG_HUMAN
64 PsiBlast_CBE 84.9069%-118 - C6 -2P54 7.5 PPARA_HUMAN
44 PsiBlast_CBE 84.8868%-121 - C6 -4BCR 5.3 PPARA_HUMAN
142 PsiBlast_CBE 84.8760%-122 - C6 -1I7I 4.0 PPARG_HUMAN
228 PsiBlast_CBE 84.8559%-125 - C6 -3OSW 6.4 PPARG_HUMAN
118 PsiBlast_CBE 84.8360%-119 - C6 -3PBA 6.1 PPARG_HUMAN
201 PsiBlast_CBE 84.7359%-118 - C6 -3VSO 7.0 PPARG_HUMAN
183 PsiBlast_CBE 84.7358%-127 - C6 -4HEE 8.8 PPARG_HUMAN
45 PsiBlast_CBE 84.7168%-118 - C6 -4BCR 5.8 PPARA_HUMAN
62 PsiBlast_CBE 84.6669%-119 - C6 -2ZNN 9.9 PPARA_HUMAN
209 PsiBlast_CBE 84.6459%-118 - C6 -3AN4 7.9 PPARG_HUMAN
168 PsiBlast_CBE 84.6560%-124 - C6 -4CI5 6.6 PPARG_HUMAN
99 PsiBlast_CBE 84.6460%-125 - C6 -4A4V 4.0 PPARG_HUMAN
105 PsiBlast_CBE 84.6160%-124 - C6 -3ADW 3.1 PPARG_HUMAN
119 PsiBlast_CBE 84.4360%-124 - C6 -3R5N 5.2 PPARG_HUMAN
55 PsiBlast_CBE 84.4268%-118 - C6 -3ET1 6.7 PPARA_HUMAN
151 PsiBlast_CBE 84.3660%-127 - C6 -3G9E 6.1 PPARG_HUMAN
176 PsiBlast_CBE 84.2560%-125 - C6 -2POB 6.6 PPARG_HUMAN
100 PsiBlast_CBE 84.1860%-120 - C6 -4A4V 4.9 PPARG_HUMAN
143 PsiBlast_CBE 84.1259%-120 - C6 -3ET3 6.1 PPARG_HUMAN
210 PsiBlast_CBE 84.1159%-118 - C6 -3AN3 4.7 PPARG_HUMAN
135 PsiBlast_CBE 84.0560%-124 - C6 -3SZ1 4.8 PPARG_HUMAN
23 PsiBlast_CBE 83.9577%-130 - C6 -2Q5G 10.7 PPARD_HUMAN
251 HHSearch 83.8769%-120 - C6 -3VI8 7.9 PPARA_HUMAN
124 PsiBlast_CBE 83.8760%-121 - C6 -4R2U 6.3 PPARG_HUMAN