@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Z_NR1I1_VDRB: (2016-04-07 )
MESAVSTSTQVPDEFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKASFTCPFNGSCTITKDNRRHCQACRLKRCLDIGMMKEFILTDEEVQRKKELIQRRKDEEAHREAQKPRLSDEQRNIIDTLVDAHHKTYDDSYSDFSRFRPPVREGPVTRSASRAASLHSLSDASSDSFSHSPESGDRKMNLSNLLMMYQEQGLSSSPDSKEEDGSSLSMLPHLADLVSYSIQKVIGFAKMIPGFRELTAEDQIALLKSSAIEVIMLRSNQSFSLEDMSWSCGGPEFKYCVNDVTKAGHTLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPDRPGVQDHVRVEALQDKVSEVLQAYIRAHHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGGQVT

Atome Classification :

(73 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TFY_A_2(4ITF)
VDR_HUMAN
[Raw transfer]




VHW_A_2(3VHW)
VDR_HUMAN
[Raw transfer]




VDX_C_3(2HC4)
VDRA_DANRE
[Raw transfer]




BIV_C_3(2HCD)
VDRA_DANRE
[Raw transfer]




VDA_A_3(2ZL9)
VDR_RAT
[Raw transfer]




TEY_A_2(4ITE)
VDR_HUMAN
[Raw transfer]




0VP_A_3(4G1Z)
VDRA_DANRE
[Raw transfer]




ED9_A_2(3WGP)
VDR_HUMAN
[Raw transfer]




484_A_3(4G20)
VDRA_DANRE
[Raw transfer]




0VK_A_3(4G1D)
VDRA_DANRE
[Raw transfer]




BIV_A_3(4IA3)
VDRA_DANRE
[Raw transfer]




O1C_B_2(2HB7)
VDR_HUMAN
[Raw transfer]




OCC_B_2(2HAR)
VDR_HUMAN
[Raw transfer]




MVD_B_2(2HB8)
VDR_HUMAN
[Raw transfer]




0VO_A_3(4G1Y)
VDRA_DANRE
[Raw transfer]




0S4_A_3(4FHI)
VDRA_DANRE
[Raw transfer]




BIV_A_3(4IA2)
VDRA_DANRE
[Raw transfer]




VDB_A_3(2ZLA)
VDR_RAT
[Raw transfer]




XE4_C_3(2HBH)
VDRA_DANRE
[Raw transfer]




FMV_A_2(3TKC)
?
[Raw transfer]




BIV_A_3(4IA7)
VDRA_DANRE
[Raw transfer]




C3O_B_2(2HAS)
VDR_HUMAN
[Raw transfer]




C33_B_2(2HAM)
VDR_HUMAN
[Raw transfer]




0VP_A_3(4G21)
VDRA_DANRE
[Raw transfer]




FMV_A_2(3OGT)
VDR_HUMAN
[Raw transfer]




BIV_A_3(4IA1)
VDRA_DANRE
[Raw transfer]




VDX_B_2(1DB1)
VDR_HUMAN
[Raw transfer]




EB1_B_2(1S0Z)
VDR_HUMAN
[Raw transfer]




TX5_B_2(1TXI)
VDR_HUMAN
[Raw transfer]




VDX_A_2(3M7R)
VDR_HUMAN
[Raw transfer]




0VQ_A_3(4G2H)
VDRA_DANRE
[Raw transfer]




VDX_C_3(1RK3)
VDR_RAT
[Raw transfer]




YSD_A_3(3VRV)
VDR_RAT
[Raw transfer]




KH1_B_2(1IE8)
VDR_HUMAN
[Raw transfer]




MCZ_A_2(3B0T)
VDR_HUMAN
[Raw transfer]




DS6_A_2(3AZ3)
VDR_HUMAN
[Raw transfer]




YS5_A_3(3VRW)
VDR_RAT
[Raw transfer]




VD5_A_3(2O4R)
VDR_RAT
[Raw transfer]




COV_A_2(3CS4)
VDR_HUMAN
[Raw transfer]




0CO_A_2(3CS6)
VDR_HUMAN
[Raw transfer]




2MV_X_2(3A3Z)
VDR_HUMAN
[Raw transfer]




ZYD_A_2(3P8X)
VDR_HUMAN
[Raw transfer]




TEJ_A_2(3A2I)
VDR_HUMAN
[Raw transfer]




0U3_A_3(4FHH)
VDRA_DANRE
[Raw transfer]




DS3_A_2(3AZ2)
VDR_HUMAN
[Raw transfer]




TEJ_A_3(3A2H)
VDR_RAT
[Raw transfer]




G72_A_3(3O1D)
VDRA_DANRE
[Raw transfer]




CA9_A_2(3AUQ)
VDR_HUMAN
[Raw transfer]




MC9_B_2(1S19)
VDR_HUMAN
[Raw transfer]




ZNE_A_2(3KPZ)
VDR_HUMAN
[Raw transfer]




VDX_B_2(1IE9)
VDR_HUMAN
[Raw transfer]




VD4_A_3(2O4J)
VDR_RAT
[Raw transfer]




VDZ_A_3(1RJK)
VDR_RAT
[Raw transfer]




CA9_A_2(3AUR)
VDR_HUMAN
[Raw transfer]




DS2_A_2(3AZ1)
VDR_HUMAN
[Raw transfer]




23R_X_2(3A40)
VDR_HUMAN
[Raw transfer]




EIM_A_2(3AX8)
VDR_HUMAN
[Raw transfer]




VD4_A_3(2O4J)
VDR_RAT
[Raw transfer]




C5D_A_4(3DR1)
VDRA_DANRE
[Raw transfer]




YS3_A_3(3VRU)
VDR_RAT
[Raw transfer]




3AJ_A_2(3WWR)
VDR_HUMAN
[Raw transfer]




3EV_A_2(3A78)
VDR_HUMAN
[Raw transfer]




MCZ_A_2(3B0T)
VDR_HUMAN
[Raw transfer]




H97_A_3(3O1E)
VDRA_DANRE
[Raw transfer]




6DS_A_2(3W0C)
VDR_HUMAN
[Raw transfer]




TEJ_A_2(3A2J)
VDR_HUMAN
[Raw transfer]




0VQ_A_2(4G2I)
VDR_HUMAN
[Raw transfer]




2KB_A_2(4PA2)
VDR_HUMAN
[Raw transfer]




DS5_A_2(3W0A)
VDR_HUMAN
[Raw transfer]




DS4_A_2(3W0Y)
VDR_HUMAN
[Raw transfer]




4OA_C_3(4Q0A)
VDRA_DANRE
[Raw transfer]




10S_A_3(3VJS)
VDR_RAT
[Raw transfer]




10R_A_3(3VJT)
VDR_RAT
[Raw transfer]




17 PsiBlast_PDB 90.4288%-119 - C4 -3O1D 12.6 VDRA_DANRE
10 PsiBlast_PDB 90.3488%-120 - C4 -4IA2 12.4 VDRA_DANRE
1 PsiBlast_PDB 90.1388%-118 - C4 -4FHH 10.0 VDRA_DANRE
16 PsiBlast_PDB 89.9988%-117 - C4 -3DR1 10.8 VDRA_DANRE
9 PsiBlast_PDB 89.9888%-118 - C4 -4IA1 12.3 VDRA_DANRE
18 PsiBlast_PDB 89.9788%-118 - C4 -3O1E 12.4 VDRA_DANRE
11 PsiBlast_PDB 89.9288%-121 - C4 -4IA3 12.4 VDRA_DANRE
19 PsiBlast_PDB 89.8188%-118 - C4 -4Q0A 7.6 VDRA_DANRE
14 PsiBlast_PDB 89.7788%-121 - C4 -2HC4 10.9 VDRA_DANRE
6 PsiBlast_PDB 89.4388%-120 - C4 -4G20 11.2 VDRA_DANRE
15 PsiBlast_PDB 89.4188%-120 - C4 -2HCD 12.6 VDRA_DANRE
5 PsiBlast_PDB 89.4088%-119 - C4 -4G1Z 11.6 VDRA_DANRE
4 PsiBlast_PDB 89.3188%-120 - C4 -4G1Y 9.9 VDRA_DANRE
12 PsiBlast_PDB 89.2988%-120 - C4 -4IA7 12.4 VDRA_DANRE
8 PsiBlast_PDB 88.9188%-120 - C4 -4G2H 11.6 VDRA_DANRE
3 PsiBlast_PDB 88.8788%-120 - C4 -4G1D 10.8 VDRA_DANRE
7 PsiBlast_PDB 88.6388%-120 - C4 -4G21 10.7 VDRA_DANRE
2 PsiBlast_PDB 88.6288%-120 - C4 -4FHI 10.3 VDRA_DANRE
13 PsiBlast_PDB 88.5888%-116 - C4 -2HBH 10.7 VDRA_DANRE
53 PsiBlast_CBE 79.0162%-119 - C4 -2ZL9 11.6 VDR_RAT
52 PsiBlast_CBE 78.7962%-116 - C4 -2ZLA 11.7 VDR_RAT
51 PsiBlast_CBE 78.6862%-112 - C4 -3VJS 8.8 VDR_RAT
50 PsiBlast_CBE 78.6162%-116 - C4 -3VJT 8.7 VDR_RAT
65 PsiBlast_CBE 78.6063%-112 - C4 -3W0C 12.8 VDR_HUMAN
63 PsiBlast_CBE 78.5163%-111 - C4 -3WGP 12.1 VDR_HUMAN
64 PsiBlast_CBE 78.4963%-112 - C4 -3W0Y 13.5 VDR_HUMAN
56 PsiBlast_CBE 78.3362%-105 - C4 -3OGT 11.6 VDR_HUMAN
55 PsiBlast_CBE 78.2662%-105 - C4 -3TKC 11.7 ?
69 PsiBlast_CBE 78.1063%-112 - C4 -3AZ1 10.0 VDR_HUMAN
45 PsiBlast_CBE 78.0562%-113 - C4 -3A2H 10.5 VDR_RAT
35 PsiBlast_CBE 78.0162%-106 - C4 -3A40 11.8 VDR_HUMAN
68 PsiBlast_CBE 78.0063%-112 - C4 -3AZ2 11.2 VDR_HUMAN
24 PsiBlast_CBE 78.0062%-106 - C4 -4PA2 11.6 VDR_HUMAN
67 PsiBlast_CBE 77.9563%-112 - C4 -3AZ3 12.6 VDR_HUMAN
20 PsiBlast_PDB 77.9262%-113 - C4 -1RJK 11.5 VDR_RAT
39 PsiBlast_CBE 77.9062%-107 - C4 -2HAS 12.1 VDR_HUMAN
40 PsiBlast_CBE 77.8962%-108 - C4 -2HAR 12.5 VDR_HUMAN
59 PsiBlast_CBE 77.8862%-110 - C4 -1IE8 11.2 VDR_HUMAN
21 PsiBlast_CBE 77.8262%-112 - C4 -2O4R 11.2 VDR_RAT
36 PsiBlast_CBE 77.7862%-107 - C4 -3A3Z 11.9 VDR_HUMAN
66 PsiBlast_CBE 77.7763%-113 - C4 -3W0A 12.5 VDR_HUMAN
60 PsiBlast_CBE 77.7662%-111 - C4 -1DB1 10.9 VDR_HUMAN
62 PsiBlast_CBE 77.7563%-107 - C4 -3B0T 11.1 VDR_HUMAN
27 PsiBlast_CBE 77.6762%-106 - C4 -3WWR 12.0 VDR_HUMAN
47 PsiBlast_CBE 77.6062%-120 - C4 -3VRW 11.9 VDR_RAT
38 PsiBlast_CBE 77.6062%-106 - C4 -2HB7 12.4 VDR_HUMAN
58 PsiBlast_CBE 77.5762%-106 - C4 -1IE9 11.2 VDR_HUMAN
31 PsiBlast_CBE 77.5762%-106 - C4 -3AX8 11.3 VDR_HUMAN
44 PsiBlast_CBE 77.5562%-107 - C4 -1S0Z 11.3 VDR_HUMAN
29 PsiBlast_CBE 77.5562%-107 - C4 -3CS6 11.3 VDR_HUMAN
23 PsiBlast_CBE 77.5362%-119 - C4 -1RK3 11.2 VDR_RAT
41 PsiBlast_CBE 77.4862%-106 - C4 -2HAM 12.2 VDR_HUMAN
26 PsiBlast_CBE 77.3962%-108 - C4 -4ITE 12.9 VDR_HUMAN
49 PsiBlast_CBE 77.3362%-116 - C4 -3VRU 10.3 VDR_RAT
54 PsiBlast_CBE 77.2862%-110 - C4 -4G2I 11.8 VDR_HUMAN
22 PsiBlast_CBE 77.2562%-113 - C4 -2O4J 11.6 VDR_RAT
43 PsiBlast_CBE 77.1962%-108 - C4 -1S19 10.8 VDR_HUMAN
34 PsiBlast_CBE 77.1862%-106 - C4 -3A78 10.9 VDR_HUMAN
42 PsiBlast_CBE 77.1662%-108 - C4 -1TXI 10.4 VDR_HUMAN
48 PsiBlast_CBE 77.1562%-119 - C4 -3VRV 11.4 VDR_RAT
37 PsiBlast_CBE 77.1262%-106 - C4 -2HB8 11.5 VDR_HUMAN
70 PsiBlast_CBE 77.1161%-105 - C4 -3A2J 10.5 VDR_HUMAN
28 PsiBlast_CBE 76.9662%-102 - C4 -3VHW 13.1 VDR_HUMAN
25 PsiBlast_CBE 76.9162%-107 - C4 -4ITF 13.2 VDR_HUMAN
57 PsiBlast_CBE 76.7162%-109 - C4 -3KPZ 11.0 VDR_HUMAN
46 PsiBlast_CBE 76.7162%-105 - C4 -3P8X 11.4 VDR_HUMAN
30 PsiBlast_CBE 76.6562%-106 - C4 -3CS4 11.6 VDR_HUMAN
32 PsiBlast_CBE 76.6262%-108 - C4 -3AUR 11.1 VDR_HUMAN
71 PsiBlast_CBE 76.3263%-109 - C4 -3M7R 9.7 VDR_HUMAN
33 PsiBlast_CBE 76.2862%-107 - C4 -3AUQ 11.2 VDR_HUMAN
61 PsiBlast_CBE 75.7061%-109 - C4 -3A2I 10.6 VDR_HUMAN
86 HHSearch 73.7781%-124 - C4 -2O4J 10.5 VDR_RAT
85 HHSearch 73.2181%-130 * C4 *3B0T 10.2 VDR_HUMAN