@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Z_NR3A1_ESR1: (2016-04-07 )
MYPKEEHSAGGISSSVNYLDGAYEYPNPTQTFGTSSPAEPASVGYYPAPPDPHEEHLQTLGGGSSSPLMFAPSSPQLSPYLSHHGGHHTTPHQVSYYLDSSSSTVYRSSVVSSQQAAVGLCEELCSATDRQELYTGSRAAGGFDSGKETRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYVCPATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGIRKDRGGRSVRRERRRSSNEDRDKSSSDQCSRAGVRTTGPQDKRKKRSGGVVSTLCMSPDQVLLLLLGAEPPAVCSRQKHSRPYTEITMMSLLTNMADKELVHMIAWAKKVPGFQDLSLHDQVQLLESSWLEVLMIGLIWRSIHSPGKLIFAQDLILDRSEGECVEGMAEIFDMLLATVARFRSLKLKLEEFVCLKAIILINSGAFSFCSSPVEPLMDNFMVQCMLDNITDALIYCISKSGASLQLQSRRQAQLLLLLSHIRHMSNKGMEHLYRMKCKNRVPLYDLLLEMLDAQRFQSSGKVQRVWSQSEKNPPSTPTTSSSSSNNSPRGGAAAIQSNGACHSHSPDP

Atome Classification :

(139 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ESE_B_6(4PPS)

[Raw transfer]




ZTW_B_6(1GWQ)

[Raw transfer]




ESE_A_5(4PPS)
ESR1_HUMAN
[Raw transfer]




EST_A_5(4PXM)
ESR1_HUMAN
[Raw transfer]




EST_B_6(4PXM)

[Raw transfer]




OHT_C_14(2JF9)

[Raw transfer]




JJ3_A_3(2QE4)
ESR1_HUMAN
[Raw transfer]




EED_B_6(2QGT)

[Raw transfer]




EST_B_4(1A52)

[Raw transfer]




EED_A_5(2QGT)
ESR1_HUMAN
[Raw transfer]




EST_A_5(1GWR)
ESR1_HUMAN
[Raw transfer]




1GV_A_5(4IWC)
ESR1_HUMAN
[Raw transfer]




EI1_A_5(2QAB)
ESR1_HUMAN
[Raw transfer]




E3O_A_3(2J7Y)

[Raw transfer]




EST_A_3(1A52)
ESR1_HUMAN
[Raw transfer]




EST_B_3(2YJA)

[Raw transfer]




EST_E_5(1G50)
ESR1_HUMAN
[Raw transfer]




L4G_B_2(2AYR)

[Raw transfer]




EST_A_3(2OCF)

[Raw transfer]




EI1_B_6(2QAB)

[Raw transfer]




EST_B_6(1GWR)

[Raw transfer]




EST_E_5(1PCG)
ESR1_HUMAN
[Raw transfer]




ESL_A_5(3Q95)
ESR1_HUMAN
[Raw transfer]




EST_B_7(1QKU)
ESR1_HUMAN
[Raw transfer]




4OH_A_7(3L03)
ESR1_HUMAN
[Raw transfer]




ZTW_A_5(1GWQ)
ESR1_HUMAN
[Raw transfer]




OHT_B_11(2JF9)
ESR1_HUMAN
[Raw transfer]




EST_C_8(1QKU)

[Raw transfer]




0L8_B_6(4DMA)

[Raw transfer]




244_E_5(1X7E)
ESR1_HUMAN
[Raw transfer]




244_F_6(1X7E)

[Raw transfer]




4OH_B_8(3L03)

[Raw transfer]




AEJ_G_7(1XQC)
ESR1_HUMAN
[Raw transfer]




J2Z_A_5(3HLV)
ESR1_HUMAN
[Raw transfer]




J2Z_B_6(3HLV)

[Raw transfer]




OHT_A_2(3ERT)

[Raw transfer]




WST_A_3(2POG)
ESR1_HUMAN
[Raw transfer]




AEJ_F_6(1XQC)
ESR1_HUMAN
[Raw transfer]




1GV_B_6(4IWC)

[Raw transfer]




EST_G_7(1G50)

[Raw transfer]




EZT_A_5(2P15)
ESR1_HUMAN
[Raw transfer]




JJ3_B_4(2QE4)

[Raw transfer]




EST_F_6(1G50)
ESR1_HUMAN
[Raw transfer]




OHT_A_5(2BJ4)
ESR1_HUMAN
[Raw transfer]




KN2_B_6(2QA6)

[Raw transfer]




C3D_C_3(2OUZ)

[Raw transfer]




AEJ_E_5(1XQC)
ESR1_HUMAN
[Raw transfer]




EZT_B_6(2P15)

[Raw transfer]




OHT_A_7(2JF9)
ESR1_HUMAN
[Raw transfer]




EST_A_5(1QKU)
ESR1_HUMAN
[Raw transfer]




EST_B_3(1QKT)

[Raw transfer]




EST_F_6(1PCG)

[Raw transfer]




CM4_C_3(1YIM)

[Raw transfer]




AEJ_H_8(1XQC)

[Raw transfer]




WST_B_4(2POG)

[Raw transfer]




KN2_A_5(2QA6)
ESR1_HUMAN
[Raw transfer]




LLC_B_4(2R6Y)

[Raw transfer]




369_A_3(3DT3)
ESR1_HUMAN
[Raw transfer]




RAL_B_4(2QXS)

[Raw transfer]




LLB_A_3(2R6W)
ESR1_HUMAN
[Raw transfer]




AIJ_C_3(1XP9)

[Raw transfer]




AIT_C_3(1XPC)

[Raw transfer]




LLC_A_3(2R6Y)
ESR1_HUMAN
[Raw transfer]




STL_A_5(4PP6)
ESR1_HUMAN
[Raw transfer]




GEN_B_6(2QA8)

[Raw transfer]




AIU_C_3(1XP6)

[Raw transfer]




EEU_A_3(2YAT)

[Raw transfer]




I0G_D_8(2I0J)

[Raw transfer]




I0G_B_6(2I0J)
ESR1_HUMAN
[Raw transfer]




AIH_C_3(1XP1)

[Raw transfer]




0L8_A_5(4DMA)
ESR1_HUMAN
[Raw transfer]




CM3_C_3(1YIN)

[Raw transfer]




15Q_B_6(4IWF)

[Raw transfer]




I0G_A_5(2I0J)
ESR1_HUMAN
[Raw transfer]




GEN_A_5(2QA8)
ESR1_HUMAN
[Raw transfer]




GEN_E_5(1X7R)

[Raw transfer]




E4D_C_3(1SJ0)

[Raw transfer]




EES_A_5(2QGW)
ESR1_HUMAN
[Raw transfer]




1HP_B_6(2QSE)

[Raw transfer]




1GR_B_6(4IV2)

[Raw transfer]




STL_B_6(4PP6)

[Raw transfer]




RAL_A_5(2JFA)
ESR1_HUMAN
[Raw transfer]




1GQ_B_6(4IUI)

[Raw transfer]




I0G_C_7(2I0J)
ESR1_HUMAN
[Raw transfer]




1GT_B_6(4IVY)

[Raw transfer]




85Z_A_3(5AK2)
ESR1_HUMAN
[Raw transfer]




GW5_E_5(1R5K)
ESR1_HUMAN
[Raw transfer]




DC8_A_3(2Q70)
ESR1_HUMAN
[Raw transfer]




GW5_F_6(1R5K)
ESR1_HUMAN
[Raw transfer]




IOG_A_2(2IOG)

[Raw transfer]




HZ3_A_5(2QR9)
ESR1_HUMAN
[Raw transfer]




RAL_A_3(2QXS)
ESR1_HUMAN
[Raw transfer]




1GT_A_5(4IVY)
ESR1_HUMAN
[Raw transfer]




HZ3_B_6(2QR9)

[Raw transfer]




1GU_B_6(4IW6)

[Raw transfer]




1GJ_A_5(4IVW)
ESR1_HUMAN
[Raw transfer]




EES_B_6(2QGW)

[Raw transfer]




1GJ_B_6(4IVW)

[Raw transfer]




KN3_A_5(4IW8)
ESR1_HUMAN
[Raw transfer]




GW5_G_7(1R5K)

[Raw transfer]




15Q_A_5(4IWF)
ESR1_HUMAN
[Raw transfer]




KN3_B_6(4IW8)

[Raw transfer]




DC8_B_4(2Q70)

[Raw transfer]




LLB_B_4(2R6W)

[Raw transfer]




FSV_B_6(4PPP)

[Raw transfer]




1GU_A_5(4IW6)
ESR1_HUMAN
[Raw transfer]




1HP_A_5(2QSE)
ESR1_HUMAN
[Raw transfer]




KN0_B_6(3OS8)
ESR1_HUMAN
[Raw transfer]




KN3_B_6(3OSA)
ESR1_HUMAN
[Raw transfer]




1GR_A_5(4IV2)
ESR1_HUMAN
[Raw transfer]




FSV_A_5(4PPP)
ESR1_HUMAN
[Raw transfer]




ODE_B_6(2QH6)

[Raw transfer]




1GM_A_5(4IU7)
ESR1_HUMAN
[Raw transfer]




IOK_A_3(2IOK)
ESR1_HUMAN
[Raw transfer]




0D1_A_5(3UUC)
ESR1_HUMAN
[Raw transfer]




85Z_B_4(5AK2)

[Raw transfer]




KN0_A_5(3OS8)
ESR1_HUMAN
[Raw transfer]




PIQ_B_6(2QXM)

[Raw transfer]




1GM_B_6(4IU7)

[Raw transfer]




A48_A_5(2Q6J)
ESR1_HUMAN
[Raw transfer]




1GS_A_5(4IV4)
ESR1_HUMAN
[Raw transfer]




ODE_A_5(2QH6)
ESR1_HUMAN
[Raw transfer]




1GS_B_6(4IV4)

[Raw transfer]




KN3_D_8(3OSA)

[Raw transfer]




OBH_B_6(4ZN9)
?
[Raw transfer]




KN0_D_8(3OS8)

[Raw transfer]




OBH_A_5(4ZN9)
?
[Raw transfer]




IOK_B_4(2IOK)

[Raw transfer]




KN1_A_5(2QZO)
ESR1_HUMAN
[Raw transfer]




PIQ_A_5(2QXM)
ESR1_HUMAN
[Raw transfer]




KN0_C_7(3OS8)
ESR1_HUMAN
[Raw transfer]




A48_B_6(2Q6J)

[Raw transfer]




KN3_C_7(3OSA)
ESR1_HUMAN
[Raw transfer]




KN1_B_7(3OS9)
ESR1_HUMAN
[Raw transfer]




KN1_A_5(3OS9)
ESR1_HUMAN
[Raw transfer]




KN1_D_12(3OS9)

[Raw transfer]




KN1_D_11(3OS9)

[Raw transfer]




KN1_C_9(3OS9)
ESR1_HUMAN
[Raw transfer]




EDO_A_7(2J7X)

[Raw transfer]




39 PsiBlast_CBE 90.9563%-153 - C3 -1XPC 10.7
5 PsiBlast_PDB 90.9362%-135 - C3 -2YJA 7.9
133 PsiBlast_CBE 90.8063%-143 - C3 -4PP6 5.2 ESR1_HUMAN
53 PsiBlast_CBE 90.7561%-138 - C3 -2QR9 4.8
14 PsiBlast_PDB 90.7461%-139 - C3 -2QA8 7.5
51 PsiBlast_CBE 90.7261%-137 - C3 -2QSE 6.2
18 PsiBlast_PDB 90.6663%-145 - C3 -1XP1 10.9
118 PsiBlast_CBE 90.6063%-146 - C3 -4IVW 8.9 ESR1_HUMAN
57 PsiBlast_CBE 90.5661%-138 - C3 -2QGW 6.5
65 PsiBlast_CBE 90.5361%-134 - C3 -2Q6J 7.6
128 PsiBlast_CBE 90.5163%-142 - C3 -4PPS 6.8
19 PsiBlast_PDB 90.5163%-148 - C3 -1XP6 11.3
116 PsiBlast_CBE 90.4963%-143 - C3 -4IVY 7.4 ESR1_HUMAN
56 PsiBlast_CBE 90.4961%-142 - C3 -2QH6 6.5 ESR1_HUMAN
38 PsiBlast_CBE 90.4963%-146 - C3 -1YIM 10.2
108 PsiBlast_CBE 90.4663%-141 - C3 -4IWF 6.0 ESR1_HUMAN
216 HHSearch 90.4263%-154 - C3 -1XPC - -
42 PsiBlast_CBE 90.3863%-137 - C3 -1QKU 7.2 ESR1_HUMAN
62 PsiBlast_CBE 90.3661%-139 - C3 -2QAB 6.6 ESR1_HUMAN
121 PsiBlast_CBE 90.3263%-144 - C3 -4IV2 7.7
141 PsiBlast_CBE 90.3061%-149 - C3 -2QXS 10.5 ESR1_HUMAN
102 PsiBlast_CBE 90.2863%-147 - C3 -4DMA 6.8
139 PsiBlast_CBE 90.2763%-149 - C3 -1PCG 7.5 ESR1_HUMAN
64 PsiBlast_CBE 90.2561%-135 - C3 -2QA6 6.2 ESR1_HUMAN
103 PsiBlast_CBE 90.2363%-138 - C3 -4DMA 6.9 ESR1_HUMAN
131 PsiBlast_CBE 90.2263%-148 - C3 -4PPP 5.7 ESR1_HUMAN
105 PsiBlast_CBE 90.2063%-142 - C3 -1X7E 7.2
109 PsiBlast_CBE 90.1863%-142 - C3 -4IWC 7.6
20 PsiBlast_PDB 90.1563%-147 - C3 -1XP9 10.3
61 PsiBlast_CBE 90.1461%-138 - C3 -2QAB 6.0
17 PsiBlast_PDB 90.1363%-150 - C3 -1SJ0 10.6
40 PsiBlast_CBE 90.0863%-137 - C3 -1QKU 7.2
48 PsiBlast_CBE 90.0363%-146 - C3 -2IOG 11.6
143 PsiBlast_CBE 90.0161%-141 - C3 -3L03 7.5
69 PsiBlast_CBE 90.0263%-143 - C3 -1GWR 7.5
50 PsiBlast_CBE 90.0161%-140 - C3 -2QXM 5.6 ESR1_HUMAN
60 PsiBlast_CBE 89.9961%-139 - C3 -2QGT 8.3 ESR1_HUMAN
52 PsiBlast_CBE 89.9861%-144 - C3 -2QSE 6.2 ESR1_HUMAN
122 PsiBlast_CBE 89.9463%-146 - C3 -4IV2 8.2 ESR1_HUMAN
41 PsiBlast_CBE 89.9463%-140 - C3 -1QKU 6.9 ESR1_HUMAN
117 PsiBlast_CBE 89.9163%-141 - C3 -4IVW 8.6
58 PsiBlast_CBE 89.9161%-138 - C3 -2QGW 6.2 ESR1_HUMAN
106 PsiBlast_CBE 89.8963%-141 - C3 -1X7E 7.1 ESR1_HUMAN
144 PsiBlast_CBE 89.8761%-139 - C3 -3L03 7.4 ESR1_HUMAN
125 PsiBlast_CBE 89.8263%-140 - C3 -4IU7 7.7 ESR1_HUMAN
67 PsiBlast_CBE 89.8161%-138 - C3 -2P15 11.3
44 PsiBlast_CBE 89.8163%-141 - C3 -1GWQ 6.5 ESR1_HUMAN
140 PsiBlast_CBE 89.7961%-151 - C3 -2QXS 10.7
10 PsiBlast_PDB 89.7561%-133 - C3 -3Q95 7.4 ESR1_HUMAN
132 PsiBlast_CBE 89.7463%-143 - C3 -4PP6 5.3
46 PsiBlast_CBE 89.7063%-140 - C3 -1G50 7.0 ESR1_HUMAN
129 PsiBlast_CBE 89.6863%-137 - C3 -4PPS 6.6 ESR1_HUMAN
142 PsiBlast_CBE 89.6561%-143 - C3 -2QA8 7.3 ESR1_HUMAN
138 PsiBlast_CBE 89.6563%-139 - C3 -1PCG 7.6
9 PsiBlast_PDB 89.6159%-144 - C3 -4PXM 7.8 ESR1_HUMAN
82 PsiBlast_CBE 89.5862%-150 - C3 -2R6Y 9.9 ESR1_HUMAN
91 PsiBlast_CBE 89.5762%-144 - C3 -2AYR 10.3
63 PsiBlast_CBE 89.5761%-138 - C3 -2QA6 6.3
49 PsiBlast_CBE 89.5761%-138 - C3 -2QXM 5.2
84 PsiBlast_CBE 89.5662%-153 - C3 -2R6W 9.6 ESR1_HUMAN
74 PsiBlast_CBE 89.5562%-153 - C3 -1XQC 10.5 ESR1_HUMAN
130 PsiBlast_CBE 89.5063%-142 - C3 -4PPP 5.1
110 PsiBlast_CBE 89.5063%-141 - C3 -4IWC 7.8 ESR1_HUMAN
47 PsiBlast_CBE 89.4763%-135 - C3 -1G50 7.7 ESR1_HUMAN
115 PsiBlast_CBE 89.4663%-139 - C3 -4IVY 7.1
112 PsiBlast_CBE 89.4563%-138 - C3 -4IW8 7.1 ESR1_HUMAN
70 PsiBlast_CBE 89.4263%-139 - C3 -1GWR 7.4 ESR1_HUMAN
77 PsiBlast_CBE 89.4161%-136 - C3 -3HLV 7.2 ESR1_HUMAN
59 PsiBlast_CBE 89.4161%-136 - C3 -2QGT 8.3
37 PsiBlast_CBE 89.4163%-149 - C3 -1YIN 9.8
13 PsiBlast_PDB 89.4063%-146 - C3 -2OUZ 10.1
72 PsiBlast_CBE 89.3862%-149 - C3 -1XQC 10.7 ESR1_HUMAN
68 PsiBlast_CBE 89.3761%-133 - C3 -2P15 11.4 ESR1_HUMAN
124 PsiBlast_CBE 89.3263%-140 - C3 -4IU7 6.6
54 PsiBlast_CBE 89.3361%-139 - C3 -2QR9 5.1 ESR1_HUMAN
114 PsiBlast_CBE 89.3263%-142 - C3 -4IW6 8.3 ESR1_HUMAN
45 PsiBlast_CBE 89.3263%-139 - C3 -1G50 7.4
100 PsiBlast_CBE 89.2961%-144 - C3 -3OS8 9.2
43 PsiBlast_CBE 89.2163%-140 - C3 -1GWQ 6.5