@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Z_NR3C3_PRGR: (2016-07-28 )
MLGGRKMKRFAGLKVMGLSPSLMFQSPLSLLTDGQTLSSLPCMSAMRELQLSPQMISILENIEPQVVYSGYDNTQPEVPHLLLNSLNRLCERQLLWIVRWSKSLPGFRNLHINDQMTLIQYSWMGLMLFSLGWRTFQNVTPDYLYFAPDLVLSNDQLRRSPIYDLCLAMQFVPQEFANLQVTKEEFLCMKALMLLNTVPLEGLKSQTQFDEMRQNYICELSKAIQLKEKGVVASSQRFYHLTKLMDNMHEIVKKVNLYCLSTFIQADAMKVEFPEMMTEVIASQLPKVLAGMVKPLMFHHK

Atome Classification :

(79 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

A2K_B_5(4APU)

[Raw transfer]




WOW_A_3(3KBA)
PRGR_HUMAN
[Raw transfer]




1CA_A_2(4FNE)
?
[Raw transfer]




OR8_A_3(4APU)
PRGR_HUMAN
[Raw transfer]




DEX_A_5(3GN8)
?
[Raw transfer]




DEX_B_6(3GN8)
?
[Raw transfer]




AS4_A_4(2Q1H)
?
[Raw transfer]




STR_B_9(4FN9)
?
[Raw transfer]




486_A_3(2W8Y)
PRGR_HUMAN
[Raw transfer]




NOG_A_3(3D90)
PRGR_HUMAN
[Raw transfer]




2S0_A_3(4OAR)

[Raw transfer]




DEX_A_4(3MNP)

[Raw transfer]




R18_A_3(1E3K)
PRGR_HUMAN
[Raw transfer]




NOG_B_4(3D90)

[Raw transfer]




WOW_B_5(3KBA)

[Raw transfer]




NDR_D_4(1SQN)

[Raw transfer]




R18_B_4(1E3K)

[Raw transfer]




NDR_C_3(1SQN)
PRGR_HUMAN
[Raw transfer]




OR8_B_10(3ZR7)

[Raw transfer]




1CA_B_7(3RY9)
?
[Raw transfer]




T98_E_5(1ZUC)

[Raw transfer]




STR_A_2(4LTW)
?
[Raw transfer]




STR_A_3(4FN9)
?
[Raw transfer]




ORB_A_3(3ZRA)
PRGR_HUMAN
[Raw transfer]




STR_B_4(1A28)

[Raw transfer]




1CA_A_4(3RY9)
?
[Raw transfer]




OR8_A_3(3ZR7)
PRGR_HUMAN
[Raw transfer]




NDR_C_3(1SQN)
PRGR_HUMAN
[Raw transfer]




AS0_A_3(4A2J)
PRGR_HUMAN
[Raw transfer]




STR_A_3(1A28)
PRGR_HUMAN
[Raw transfer]




MOF_A_6(4E2J)
?
[Raw transfer]




TES_A_3(2YHD)

[Raw transfer]




AS0_C_3(2OVM)

[Raw transfer]




DHT_A_3(2PKL)

[Raw transfer]




ORC_B_8(3ZRB)

[Raw transfer]




DHT_A_3(3L3Z)

[Raw transfer]




AS0_B_5(4A2J)

[Raw transfer]




DHT_A_3(3L3X)

[Raw transfer]




DHT_A_3(2PIO)

[Raw transfer]




AS0_A_3(2OVH)

[Raw transfer]




DHT_L_5(2PIP)
?
[Raw transfer]




DHT_A_3(2PIV)

[Raw transfer]




R18_B_2(1XQ3)
?
[Raw transfer]




R18_C_3(1XOW)

[Raw transfer]




DHT_A_2(2PIX)

[Raw transfer]




T98_D_4(1ZUC)
PRGR_HUMAN
[Raw transfer]




OR8_A_3(3ZRB)
PRGR_HUMAN
[Raw transfer]




DHT_C_3(1T5Z)

[Raw transfer]




DHT_A_2(2PIW)

[Raw transfer]




GKK_A_7(3HQ5)
PRGR_HUMAN
[Raw transfer]




DHT_C_3(1T65)

[Raw transfer]




GKK_B_9(3HQ5)

[Raw transfer]




DHT_A_3(2QPY)

[Raw transfer]




DHT_A_3(2PIT)

[Raw transfer]




DHT_A_3(2Z4J)

[Raw transfer]




NDR_B_5(2W8Y)

[Raw transfer]




DHT_A_3(4OFR)

[Raw transfer]




R18_C_3(2AO6)

[Raw transfer]




DHT_A_3(2PIR)

[Raw transfer]




DHT_C_3(1T63)

[Raw transfer]




DHT_A_3(2PIQ)
?
[Raw transfer]




DHT_A_2(2PIU)

[Raw transfer]




MOF_A_4(1SR7)
PRGR_HUMAN
[Raw transfer]




MOF_B_7(4E2J)
?
[Raw transfer]




ORB_B_5(3ZRA)

[Raw transfer]




CA4_A_2(2OZ7)

[Raw transfer]




MOF_B_5(1SR7)

[Raw transfer]




STR_A_3(1A28)
PRGR_HUMAN
[Raw transfer]




RLL_A_2(3RLL)

[Raw transfer]




HFN_A_2(4PF3)

[Raw transfer]




30X_A_3(3G8O)
PRGR_HUMAN
[Raw transfer]




30X_B_4(3G8O)

[Raw transfer]




HFT_A_3(4OJ9)

[Raw transfer]




3B6_A_2(3B65)

[Raw transfer]




RLJ_A_2(3RLJ)
?
[Raw transfer]




B66_A_2(3B66)

[Raw transfer]




B68_A_2(3B68)

[Raw transfer]




B67_A_2(3B67)

[Raw transfer]




B5R_A_2(3B5R)

[Raw transfer]




PK1_A_3(3V4A)

[Raw transfer]




LGD_A_2(2HVC)

[Raw transfer]




28 PsiBlast_CBE 93.7165%-157 - C5 -3HQ5 7.9
21 PsiBlast_CBE 93.3564%-156 - C5 -3G8O 6.4
3 PsiBlast_PDB 92.7865%-156 - C5 -3ZR7 7.4 PRGR_HUMAN
29 PsiBlast_CBE 92.6165%-151 - C5 -1A28 8.3
12 PsiBlast_PDB 92.6064%-158 - C5 -1E3K 7.2 PRGR_HUMAN
11 PsiBlast_PDB 92.4865%-160 - C5 -3HQ5 8.3 PRGR_HUMAN
63 PsiBlast_CBE 92.3951%-162 - C5 -2QPY 6.9
35 PsiBlast_CBE 92.2765%-156 - C5 -3KBA 7.0
19 PsiBlast_PDB 92.2760%-150 - C5 -4LTW 7.8 ?
6 PsiBlast_PDB 92.2565%-155 - C5 -4A2J 4.6 PRGR_HUMAN
15 PsiBlast_PDB 92.2164%-156 - C5 -1ZUC 7.8
2 PsiBlast_PDB 92.1165%-153 - C5 -2W8Y 6.7 PRGR_HUMAN
33 PsiBlast_CBE 91.9064%-157 - C5 -1SR7 7.5
7 PsiBlast_PDB 91.4765%-151 - C5 -4APU 6.1 PRGR_HUMAN
5 PsiBlast_PDB 91.3965%-148 - C5 -3ZRB 7.3 PRGR_HUMAN
34 PsiBlast_CBE 91.2564%-152 - C5 -1SQN 6.7
30 PsiBlast_CBE 91.2164%-151 - C5 -3D90 7.3
13 PsiBlast_PDB 91.1664%-148 - C5 -3D90 7.4 PRGR_HUMAN
64 PsiBlast_CBE 91.1351%-144 - C5 -2PKL 7.0
4 PsiBlast_PDB 91.0165%-154 - C5 -3ZRA 6.8 PRGR_HUMAN
8 PsiBlast_PDB 90.9765%-154 - C5 -1A28 8.0 PRGR_HUMAN
91 HHSearch 90.7665%-154 - C5 -1SQN 7.3 PRGR_HUMAN
22 PsiBlast_CBE 90.7665%-153 - C5 -4APU 11.3
31 PsiBlast_CBE 90.6564%-156 - C5 -1E3K 7.5
24 PsiBlast_CBE 90.6565%-155 - C5 -3ZRB 5.8
17 PsiBlast_PDB 90.4464%-154 - C5 -1SQN 7.3 PRGR_HUMAN
32 PsiBlast_CBE 90.4264%-149 - C5 -1ZUC 6.5 PRGR_HUMAN
25 PsiBlast_CBE 90.1265%-149 - C5 -3ZRA 6.5
36 PsiBlast_CBE 89.8060%-146 - C5 -4FN9 6.5 ?
70 PsiBlast_CBE 89.7351%-153 - C5 -2PIR 7.1
1 PsiBlast_PDB 89.6664%-152 - C5 -3G8O 6.9 PRGR_HUMAN
62 PsiBlast_CBE 89.5751%-156 - C5 -2HVC 7.5
14 PsiBlast_PDB 89.5564%-153 - C5 -1SR7 10.1 PRGR_HUMAN
77 PsiBlast_CBE 89.5053%-155 - C5 -4E2J 7.8 ?
69 PsiBlast_CBE 89.5051%-151 - C5 -2PIT 6.8
27 PsiBlast_CBE 89.4465%-150 - C5 -2W8Y 7.6
37 PsiBlast_CBE 89.3460%-143 - C5 -4FN9 7.7 ?
26 PsiBlast_CBE 89.2965%-152 - C5 -3ZR7 7.5
57 PsiBlast_CBE 89.2151%-157 - C5 -3B5R 7.7
18 PsiBlast_PDB 89.1765%-165 - C5 -3KBA 8.2 PRGR_HUMAN
23 PsiBlast_CBE 89.1365%-154 - C5 -4A2J 4.3
44 PsiBlast_CBE 89.0851%-153 - C5 -4OJ9 4.3
71 PsiBlast_CBE 89.0251%-155 - C5 -2PIQ 7.1 ?
58 PsiBlast_CBE 89.0251%-157 - C5 -2YHD 7.1
49 PsiBlast_CBE 89.0251%-147 - C5 -3L3X 7.3
53 PsiBlast_CBE 89.0051%-153 - C5 -3B68 7.5
54 PsiBlast_CBE 88.9651%-148 - C5 -3B67 8.4
47 PsiBlast_CBE 88.8951%-152 - C5 -3RLJ 7.7 ?
75 PsiBlast_CBE 88.7851%-160 - C5 -1T63 6.9
68 PsiBlast_CBE 88.6951%-150 - C5 -2PIU 7.1
76 PsiBlast_CBE 88.6251%-154 - C5 -1T5Z 6.9
72 PsiBlast_CBE 88.4151%-151 - C5 -2PIP 7.1 ?
39 PsiBlast_CBE 88.3159%-159 - C5 -2Q1H 7.9 ?
73 PsiBlast_CBE 88.2251%-145 - C5 -2PIO 6.8
56 PsiBlast_CBE 88.1851%-153 - C5 -3B65 8.1
67 PsiBlast_CBE 88.1551%-152 - C5 -2PIV 6.8
42 PsiBlast_CBE 88.1553%-151 - C5 -3GN8 6.8 ?
55 PsiBlast_CBE 88.1451%-155 - C5 -3B66 8.1
51 PsiBlast_CBE 88.1051%-154 - C5 -2Z4J 6.3
9 PsiBlast_PDB 88.0765%-148 - C5 -2OVH 5.0
78 PsiBlast_CBE 87.8953%-156 - C5 -4E2J 7.4 ?
52 PsiBlast_CBE 87.8751%-155 - C5 -3V4A 7.3
61 PsiBlast_CBE 87.8151%-164 - C5 -1XOW 6.2
60 PsiBlast_CBE 87.8051%-163 - C5 -1XQ3 6.1 ?
65 PsiBlast_CBE 87.7851%-159 - C5 -2PIX 6.9
66 PsiBlast_CBE 87.6851%-153 - C5 -2PIW 7.1
50 PsiBlast_CBE 87.6251%-156 - C5 -4OFR 7.2
40 PsiBlast_CBE 87.5255%-150 - C5 -3RY9 8.0 ?
46 PsiBlast_CBE 87.0951%-156 - C5 -2OZ7 6.4
43 PsiBlast_CBE 86.8453%-151 - C5 -3GN8 6.6 ?
48 PsiBlast_CBE 86.8251%-151 - C5 -3L3Z 7.2
16 PsiBlast_PDB 86.7265%-142 - C5 -4OAR 5.3
41 PsiBlast_CBE 86.6755%-150 - C5 -3RY9 8.4 ?
59 PsiBlast_CBE 86.6451%-161 - C5 -2AO6 7.3
20 PsiBlast_PDB 86.3260%-145 - C5 -4FNE 8.3 ?
74 PsiBlast_CBE 86.1551%-155 - C5 -1T65 6.9
45 PsiBlast_CBE 86.0951%-164 - C5 -3RLL 8.9
10 PsiBlast_PDB 85.7865%-148 - C5 -2OVM 4.6
79 Fugue 69.6756% -38 - C5 -1A28 7.6 PRGR_HUMAN