@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : ANM2_MOUSE: (2014-04-04 )
MEAPGEGPCSESQVIPVLEEDPVDYGCEMQLLQDGAQLQLQLQPEEFVAIADYTATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHLGKQLEEYDPEDTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAYEFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQPQQVVSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVHGFCCVTKKSGMEKAHVCLSELGCHVRTRSHVSTELETGSFRSGGDS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_A_6(1OR8)
ANM1_RAT
[Raw transfer]




SAH_A_2(3Q7E)
ANM1_RAT
[Raw transfer]




SAH_C_3(1ORH)
ANM1_RAT
[Raw transfer]




SAH_A_2(1ORI)
ANM1_RAT
[Raw transfer]




SAH_A_2(2FYT)
ANM3_HUMAN
[Raw transfer]




SAH_A_2(4HC4)
ANM6_HUMAN
[Raw transfer]




SAH_B_2(1F3L)
ANM3_RAT
[Raw transfer]




0XU_A_4(4GQB)
ANM5_HUMAN
[Raw transfer]




BEN_A_5(3B3J)
CARM1_RAT
[Raw transfer]




CHAIN_C_3(1OR8)
ANM1_RAT
[Raw transfer]

-

BEN_A_5(3B3J)
CARM1_RAT
[Raw transfer]




CHAIN_B_2(1OR8)
ANM1_RAT
[Raw transfer]

-

CHAIN_D_4(1OR8)
ANM1_RAT
[Raw transfer]

-

BEN_A_3(3B3J)
CARM1_RAT
[Raw transfer]




SFG_D_11(2Y1W)
CARM1_HUMAN
[Raw transfer]




4IK_A_5(4IKP)
CARM1_HUMAN
[Raw transfer]




SFG_A_5(2Y1W)
CARM1_HUMAN
[Raw transfer]




SAH_C_7(3B3F)
CARM1_RAT
[Raw transfer]




SAH_D_6(2V74)
CARM1_MOUSE
[Raw transfer]




SAH_A_5(2Y1X)
CARM1_HUMAN
[Raw transfer]




849_A_6(2Y1W)
CARM1_HUMAN
[Raw transfer]




849_D_12(2Y1W)
CARM1_HUMAN
[Raw transfer]




GOL_A_4(4HC4)
ANM6_HUMAN
[Raw transfer]




845_A_6(2Y1X)
CARM1_HUMAN
[Raw transfer]




EDO_A_3(4HC4)
ANM6_HUMAN
[Raw transfer]




EDO_A_3(4HC4)
ANM6_HUMAN
[Raw transfer]




GOL_A_6(4IKP)
CARM1_HUMAN
[Raw transfer]




BEN_A_3(3B3J)
CARM1_RAT
[Raw transfer]




78 HHSearch 90.5436%-120 - C1 -4HC4 7.1 ANM6_HUMAN
77 HHSearch 89.6038%-115 * C1 *2FYT 7.4 ANM3_HUMAN
23 PsiBlast_CBE 88.5237%-121 - C1 -2Y1W 8.9 CARM1_HUMAN
18 PsiBlast_CBE 88.4837%-124 - C1 -3B3F 8.3 CARM1_RAT
2 PsiBlast_PDB 88.3836%-107 - C1 -1F3L 8.0 ANM3_RAT
7 PsiBlast_PDB 87.9939%-110 - C1 -4HC4 7.1 ANM6_HUMAN
12 PsiBlast_PDB 87.9137%-120 - C1 -2Y1X 8.1 CARM1_HUMAN
32 PsiBlast_CBE 87.8637%-121 - C1 -2V74 8.0 CARM1_MOUSE
80 HHSearch 87.4035%-111 - C1 -4IKP 8.4 CARM1_HUMAN
11 PsiBlast_PDB 87.3837%-121 - C1 -2Y1W 8.6 CARM1_HUMAN
20 PsiBlast_CBE 87.2937%-119 - C1 -2Y1X - CARM1_HUMAN -
9 PsiBlast_PDB 87.0737%-123 - C1 -3B3G - CARM1_RAT -
19 PsiBlast_CBE 87.0437%-123 - C1 -3B3F - CARM1_RAT -
30 PsiBlast_CBE 87.0237%-119 - C1 -2V74 - CARM1_MOUSE -
25 PsiBlast_CBE 86.9137%-120 - C1 -2Y1W - CARM1_HUMAN -
21 PsiBlast_CBE 86.8737%-120 - C1 -2Y1X - CARM1_HUMAN -
22 PsiBlast_CBE 86.8337%-119 - C1 -2Y1X - CARM1_HUMAN -
8 PsiBlast_PDB 86.7937%-124 - C1 -3B3F - CARM1_RAT -
28 PsiBlast_CBE 86.7337%-122 - C1 -4IKP - CARM1_HUMAN -
24 PsiBlast_CBE 86.7237%-120 - C1 -2Y1W - CARM1_HUMAN -


User Run : PsiBlast Ligand Search Result:

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_A_6(1OR8)
ANM1_RAT
[Raw transfer]




SAH_A_2(3Q7E)
ANM1_RAT
[Raw transfer]




SAH_C_3(1ORH)
ANM1_RAT
[Raw transfer]




SAH_A_2(1ORI)
ANM1_RAT
[Raw transfer]




SAH_A_2(2FYT)
ANM3_HUMAN
[Raw transfer]




SAH_A_2(4HC4)
ANM6_HUMAN
[Raw transfer]




SAH_B_2(1F3L)
ANM3_RAT
[Raw transfer]




0XU_A_4(4GQB)
ANM5_HUMAN
[Raw transfer]




BEN_A_5(3B3J)
CARM1_RAT
[Raw transfer]




CHAIN_C_3(1OR8)
ANM1_RAT
[Raw transfer]

-

BEN_A_5(3B3J)
CARM1_RAT
[Raw transfer]




CHAIN_B_2(1OR8)
ANM1_RAT
[Raw transfer]

-

CHAIN_D_4(1OR8)
ANM1_RAT
[Raw transfer]

-

BEN_A_3(3B3J)
CARM1_RAT
[Raw transfer]




SFG_D_11(2Y1W)
CARM1_HUMAN
[Raw transfer]




4IK_A_5(4IKP)
CARM1_HUMAN
[Raw transfer]




SFG_A_5(2Y1W)
CARM1_HUMAN
[Raw transfer]




SAH_C_7(3B3F)
CARM1_RAT
[Raw transfer]




SAH_D_6(2V74)
CARM1_MOUSE
[Raw transfer]




SAH_A_5(2Y1X)
CARM1_HUMAN
[Raw transfer]




849_A_6(2Y1W)
CARM1_HUMAN
[Raw transfer]




849_D_12(2Y1W)
CARM1_HUMAN
[Raw transfer]




GOL_A_4(4HC4)
ANM6_HUMAN
[Raw transfer]




845_A_6(2Y1X)
CARM1_HUMAN
[Raw transfer]




EDO_A_3(4HC4)
ANM6_HUMAN
[Raw transfer]




EDO_A_3(4HC4)
ANM6_HUMAN
[Raw transfer]




GOL_A_6(4IKP)
CARM1_HUMAN
[Raw transfer]




BEN_A_3(3B3J)
CARM1_RAT
[Raw transfer]




101 86.1434%-116 - C- -4QQK - ANM6_HUMAN -
102 86.0334%-115 - C- -4QPP - ANM6_HUMAN -
103 84.7734%-118 - C- -4C05 - ANM6_MOUSE -
98 83.0736%-121 - C- -4QQN - ? -
99 82.4036%-121 - C- -4HSG - ANM3_HUMAN -
100 81.2536%-122 - C- -3SMQ - ANM3_HUMAN -
111 26.2942% -30 - C- -4AFZ - ? -
114 25.5945% -47 - C- -4D8D - -
124 25.2633% -56 - C- -1WLP - -
110 25.2445% -38 - C- -3UA6 - FYN_HUMAN -
109 25.0045% -31 - C- -1FYN - -
125 24.9633% -48 - C- -1OV3 - NCF1_HUMAN -
119 24.7740% -27 - C- -4AFQ - ? -
112 24.7645% -29 - C- -3H0F - -
142 24.0633% -36 - C- -1SSH - -
117 24.0539% -30 - C- -4ESR - -
138 23.6134% -28 - C- -3GBQ - GRB2_MOUSE -
137 23.5234% -31 - C- -4GBQ - GRB2_MOUSE -
136 23.2334% -37 - C- -1AZE - GRB2_HUMAN -
140 23.1934% -35 - C- -1GBR - GRB2_MOUSE -
122 23.1234% -27 - C- -1UJ0 - -
141 22.8134% -25 - C- -1GBQ - GRB2_MOUSE -
139 22.5234% -24 - C- -2GBQ - GRB2_MOUSE -
133 22.4634% -27 - C- -2RPN - -
145 22.2634% -26 - C- -2XMF - -
120 22.1837% -25 - C- -2DRM - MYSB_ACACA -
129 22.1633% -25 - C- -2DF6 - ARHG7_RAT -
126 22.0133% -19 - C- -2P4R - ARHG7_RAT -
121 21.9137% -25 - C- -2DRK - -
127 21.7933% -13 - C- -2G6F - ARHG7_RAT -
152 21.4032% -18 - C- -2D1X - SRC8_HUMAN -
130 21.1933% -14 - C- -2AK5 - ARHG7_RAT -
132 20.8633% -13 - C- -2OI3 - HCK_HUMAN -
135 20.8433% -10 - C- -1ZSG - -
131 20.4833% -10 - C- -2OJ2 - HCK_HUMAN -
149 19.1531% 10 - C- -1W70 - NCF4_HUMAN -
148 15.6531% 70 - C- -2O31 - -
146 15.2231% 80 - C- -2O9V - -
153 14.6632% 88 - C- -2RQU - -
150 1.2753% 358 - C- -3FVE - DAPF_MYCTU -