@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : ANM5_MOUSE: (2014-04-04 )
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIHPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDVIANAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKVQQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKETNVQVLMVLGAGRGPLVNASLRAAKQAERRIRLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPKPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYRDITLSIRPETHSPGMFSWFPIFFPIKQPITVHEGQNICVRFWRCSNSKKVWYEWAVTAPVCSSIHNPTGRSYTIGL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_B_2(1F3L)
ANM3_RAT
[Raw transfer]




SAH_A_2(4HC4)
ANM6_HUMAN
[Raw transfer]




SAH_A_2(2FYT)
ANM3_HUMAN
[Raw transfer]




0XU_A_4(4GQB)
ANM5_HUMAN
[Raw transfer]




ADN_A_6(3AY0)
TRM5B_METJA
[Raw transfer]




CHAIN_C_3(4GQB)
ANM5_HUMAN
[Raw transfer]

-

BEN_A_3(3B3J)
CARM1_RAT
[Raw transfer]




SAH_A_5(4G56)
ANM5_XENLA
[Raw transfer]




SAH_A_3(3UA3)
ANM5_CAEEL
[Raw transfer]




4IK_A_5(4IKP)
CARM1_HUMAN
[Raw transfer]




SAH_C_5(3R0Q)
ANM10_ARATH
[Raw transfer]




GOL_A_6(4IKP)
CARM1_HUMAN
[Raw transfer]




BEN_A_6(3B3J)
CARM1_RAT
[Raw transfer]




CHAIN_C_3(4GQB)
ANM5_HUMAN
[Raw transfer]

-

BEN_A_7(3B3J)
CARM1_RAT
[Raw transfer]




BEN_A_4(3B3J)
CARM1_RAT
[Raw transfer]




BEN_A_2(3B3J)
CARM1_RAT
[Raw transfer]




BEN_A_5(3B3J)
CARM1_RAT
[Raw transfer]




51 HHSearch 97.3398%-118 - C4 -4GQB 8.5 ANM5_HUMAN
21 PsiBlast_CBE 95.1397%-118 - C4 -4GQB 8.5 ANM5_HUMAN
1 PsiBlast_PDB 89.8081%-118 - C4 -4G56 6.8 ANM5_XENLA
2 PsiBlast_PDB 73.4233%-105 - C4 -3UA4 5.4 ANM5_CAEEL
52 HHSearch 73.0836% -92 - C4 -3UA3 7.4 ANM5_CAEEL
3 PsiBlast_PDB 72.3133% -97 - C4 -3UA3 - ANM5_CAEEL -
41 Fugue 66.4032% -78 - C4 -3UA3 - ANM5_CAEEL -
56 HHSearch 50.3524% -87 - C4 -4IKP 6.5 CARM1_HUMAN
59 HHSearch 49.9825% -86 - C4 -3B3J 3.8 CARM1_RAT
58 HHSearch 48.8321% -81 - C4 -4HC4 6.8 ANM6_HUMAN
57 HHSearch 46.5219% -88 - C4 -3Q7E - ANM1_RAT -
53 HHSearch 46.2520% -82 - C4 -2FYT 5.2 ANM3_HUMAN
60 HHSearch 45.5020% -85 - C4 -4LWO 5.7 ?
16 PsiBlast_PDB 44.5821% -60 - C4 -4HSG - ANM3_HUMAN -
14 PsiBlast_PDB 43.8821% -59 - C4 -2FYT - ANM3_HUMAN -
15 PsiBlast_PDB 43.5621% -60 - C4 -3SMQ - ANM3_HUMAN -
55 HHSearch 42.7623% -71 - C4 -3R0Q 4.9 ANM10_ARATH
42 Fugue 42.1616% -67 - C4 -3Q7E - ANM1_RAT -
17 PsiBlast_PDB 40.6921% -47 - C4 -1F3L - ANM3_RAT -
40 PsiBlast_CBE 40.1022% -68 - C4 -3R0Q - ANM10_ARATH -