Study : Wbm0001 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: 1CP_A_2(1R3V) / Model_13(1R3V/A) = [8.0] Download918.7513.88MKEESELARIKSSKAVVSKTIKEGKQGRKIPIWLMRQAGRSLPEYRRAVKDTSSFMEICYNTDLVVELTLQPVARFSMDAAIIFSDILIVADVLGCDVDFIRGVGPTIKPVKNFKELRNPQKIETKTLPILNAIRKVRDKLPEEKSLIGFAGGPWTVASYIIEGRSSKTFSKVLNLHPSSLEQIIEQITEVTISYLVKQIEFGADVIQLFDSNAGVLSGELFEECVIKPTKKIVSAIKGKFPDFPIIGFPKSAGSLYKDYCEKTGVSAVSIDYNVPIEWAKENLKIPLQGNLNPSLLAYNKMEAIKETKRIIDCFRDLPFIFNLGHGVLPNTPIENIAALVDLVKSQ
Complex: CP3_A_2(1R3T) / Model_17(1R3T/A) = [9.5] Download697.2729.64MKEESELARIKSSKAVVSKTIKEGKQGRKIPIWLMRQAGRSLPEYRRAVKDTSSFMEICYNTDLVVELTLQPVARFSMDAAIIFSDILIVADVLGCDVDFIRGVGPTIKPVKNFKELRNPQKIETKTLPILNAIRKVRDKLPEEKSLIGFAGGPWTVASYIIEGRSSKTFSKVLNLHPSSLEQIIEQITEVTISYLVKQIEFGADVIQLFDSNAGVLSGELFEECVIKPTKKIVSAIKGKFPDFPIIGFPKSAGSLYKDYCEKTGVSAVSIDYNVPIEWAKENLKIPLQGNLNPSLLAYNKMEAIKETKRIIDCFRDLPFIFNLGHGVLPNTPIENIAALVDLVKSQ
Complex: CP3_A_2(1R3W) / Model_14(1R3W/A) = [10.3] Download644.7626.64MKEESELARIKSSKAVVSKTIKEGKQGRKIPIWLMRQAGRSLPEYRRAVKDTSSFMEICYNTDLVVELTLQPVARFSMDAAIIFSDILIVADVLGCDVDFIRGVGPTIKPVKNFKELRNPQKIETKTLPILNAIRKVRDKLPEEKSLIGFAGGPWTVASYIIEGRSSKTFSKVLNLHPSSLEQIIEQITEVTISYLVKQIEFGADVIQLFDSNAGVLSGELFEECVIKPTKKIVSAIKGKFPDFPIIGFPKSAGSLYKDYCEKTGVSAVSIDYNVPIEWAKENLKIPLQGNLNPSLLAYNKMEAIKETKRIIDCFRDLPFIFNLGHGVLPNTPIENIAALVDLVKSQ
Complex: 1CP_A_2(1R3Q) / Model_5(1R3Q/A) = [11.0] Download601.9025.97MKEESELARIKSSKAVVSKTIKEGKQGRKIPIWLMRQAGRSLPEYRRAVKDTSSFMEICYNTDLVVELTLQPVARFSMDAAIIFSDILIVADVLGCDVDFIRGVGPTIKPVKNFKELRNPQKIETKTLPILNAIRKVRDKLPEEKSLIGFAGGPWTVASYIIEGRSSKTFSKVLNLHPSSLEQIIEQITEVTISYLVKQIEFGADVIQLFDSNAGVLSGELFEECVIKPTKKIVSAIKGKFPDFPIIGFPKSAGSLYKDYCEKTGVSAVSIDYNVPIEWAKENLKIPLQGNLNPSLLAYNKMEAIKETKRIIDCFRDLPFIFNLGHGVLPNTPIENIAALVDLVKSQ
Complex: CP3_A_2(1R3Y) / Model_6(1R3Y/A) = [11.0] Download701.9827.17MKEESELARIKSSKAVVSKTIKEGKQGRKIPIWLMRQAGRSLPEYRRAVKDTSSFMEICYNTDLVVELTLQPVARFSMDAAIIFSDILIVADVLGCDVDFIRGVGPTIKPVKNFKELRNPQKIETKTLPILNAIRKVRDKLPEEKSLIGFAGGPWTVASYIIEGRSSKTFSKVLNLHPSSLEQIIEQITEVTISYLVKQIEFGADVIQLFDSNAGVLSGELFEECVIKPTKKIVSAIKGKFPDFPIIGFPKSAGSLYKDYCEKTGVSAVSIDYNVPIEWAKENLKIPLQGNLNPSLLAYNKMEAIKETKRIIDCFRDLPFIFNLGHGVLPNTPIENIAALVDLVKSQ
Consensus
[pKd Mean = 9.96]
-712
(s=109)
24
(s=5)
MKEESELARIKSSKAVVSKTIKEGKQGRKIPIWLMRQAGRSLPEYRRAVKDTSSFMEICYNTDLVVELTLQPVARFSMDAAIIFSDILIVADVLGCDVDFIRGVGPTIKPVKNFKELRNPQKIETKTLPILNAIRKVRDKLPEEKSLIGFAGGPWTVASYIIEGRSSKTFSKVLNLHPSSLEQIIEQITEVTISYLVKQIEFGADVIQLFDSNAGVLSGELFEECVIKPTKKIVSAIKGKFPDFPIIGFPKSAGSLYKDYCEKTGVSAVSIDYNVPIEWAKENLKIPLQGNLNPSLLAYNKMEAIKETKRIIDCFRDLPFIFNLGHGVLPNTPIENIAALVDLVKSQ