@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0001: (2015-11-27 )
MKEESELARIKSSKAVVSKTIKEGKQGRKIPIWLMRQAGRSLPEYRRAVKDTSSFMEICYNTDLVVELTLQPVARFSMDAAIIFSDILIVADVLGCDVDFIRGVGPTIKPVKNFKELRNPQKIETKTLPILNAIRKVRDKLPEEKSLIGFAGGPWTVASYIIEGRSSKTFSKVLNLHPSSLEQIIEQITEVTISYLVKQIEFGADVIQLFDSNAGVLSGELFEECVIKPTKKIVSAIKGKFPDFPIIGFPKSAGSLYKDYCEKTGVSAVSIDYNVPIEWAKENLKIPLQGNLNPSLLAYNKMEAIKETKRIIDCFRDLPFIFNLGHGVLPNTPIENIAALVDLVKSQ

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

1CP_A_2(1R3Q)
DCUP_HUMAN
[Raw transfer]




1CP_A_2(1R3S)
DCUP_HUMAN
[Raw transfer]




CP3_A_2(1R3Y)
DCUP_HUMAN
[Raw transfer]




CP3_A_2(1R3W)
DCUP_HUMAN
[Raw transfer]




1CP_A_2(1R3S)
DCUP_HUMAN
[Raw transfer]




CP3_A_2(2Q71)
DCUP_HUMAN
[Raw transfer]




CP3_A_2(1R3T)
DCUP_HUMAN
[Raw transfer]




1CP_A_2(1R3V)
DCUP_HUMAN
[Raw transfer]




EDO_B_10(4ZR8)
?
[Raw transfer]




EDO_A_5(4ZR8)
?
[Raw transfer]




10 PsiBlast_PDB 97.6736%-122 - C1 -4EXQ - DCUP_BURTA -
22 PsiBlast_CBE 96.4635%-109 - C1 -4WSH - DCUP_PSEAE -
2 PsiBlast_PDB 95.8834%-104 - C1 -3GW0 - DCUP_HUMAN -
9 PsiBlast_PDB 95.7434%-104 - C1 -3GW3 - DCUP_HUMAN -
15 PsiBlast_PDB 95.7134%-104 - C1 -1R3R - DCUP_HUMAN -
13 PsiBlast_PDB 95.6434%-105 - C1 -1R3V 8.0 DCUP_HUMAN
8 PsiBlast_PDB 95.6034%-105 - C1 -3GVR - DCUP_HUMAN -
25 PsiBlast_CBE 95.4236%-128 - C1 -2EJA - DCUP_AQUAE -
1 PsiBlast_PDB 95.4134%-105 - C1 -1JPH - DCUP_HUMAN -
17 PsiBlast_PDB 95.1534%-105 - C1 -1R3T 9.5 DCUP_HUMAN
21 PsiBlast_CBE 95.1435%-107 - C1 -4WSH - DCUP_PSEAE -
5 PsiBlast_PDB 95.1334%-105 - C1 -1R3Q 11.0 DCUP_HUMAN
6 PsiBlast_PDB 95.0834%-104 - C1 -1R3Y 11.0 DCUP_HUMAN
7 PsiBlast_PDB 95.0634%-105 - C1 -3GVQ - DCUP_HUMAN -
20 PsiBlast_PDB 94.9634%-105 - C1 -1JPK - DCUP_HUMAN -
16 PsiBlast_PDB 94.9234%-105 - C1 -1R3S 11.6 DCUP_HUMAN
19 PsiBlast_PDB 94.8234%-108 - C1 -2Q6Z - DCUP_HUMAN -
11 PsiBlast_PDB 94.6234%-111 - C1 -3GVV - DCUP_HUMAN -
4 PsiBlast_PDB 94.4934%-104 - C1 -1URO - DCUP_HUMAN -
3 PsiBlast_PDB 94.4934%-103 - C1 -1JPI - DCUP_HUMAN -
18 PsiBlast_PDB 94.3234%-105 - C1 -2Q71 11.5 DCUP_HUMAN
14 PsiBlast_PDB 94.2534%-105 - C1 -1R3W 10.3 DCUP_HUMAN
28 HHSearch 93.2033%-100 - C1 -1R3S 11.5 DCUP_HUMAN
23 PsiBlast_CBE 91.3535%-110 - C1 -4ZR8 2.0 ?
24 PsiBlast_CBE 91.1235%-110 - C1 -4ZR8 2.9 ?