@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0002: (2015-11-27 )
MSDLAKRMLLIKPSPTIAVTDKANRLKDEGKKICILAAGEPDFDTPDHIKKVAIQAIDEGKTKYTAVDGTRELKEAIISKLKRDNNLEYALSQVCVGAGAKQVLFNLFMATVNPGDEAIIPAPYWVSYVDMVSLFGGLPVVIECGQGLKLTPELLKNKVTKKTKWLILNSPNNPAGVVYTYGELEGIAQVLLEYPHVNIITDDIYEHIIYDEKFFTIAQVEPKLYNRVFVVNGVSKAYAMTGWRIGYIAGRSDVVKAISTLQSQSTSNPNSIAQAAAVEALNGDHSFLKERMGIFKSRRDFVIEKLNSAPGLLASIPQGAFYLFVSCKDLLGKSTKSGKVINNDLDFAEYLLEDHLVAVIPGIAFGLKNFIRISYATSQEQLEIGCNSIIKACKMLS

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ASP_D_4(1GCK)
AAT_THET8
[Raw transfer]




PLP_E_5(1GDE)
?
[Raw transfer]




PLP_F_6(1GDE)
?
[Raw transfer]




GOL_A_8(3E2Y)
KAT3_MOUSE
[Raw transfer]




PLP_A_3(1GD9)
?
[Raw transfer]




PLP_F_6(1GCK)
AAT_THET8
[Raw transfer]




PLP_A_3(1GD9)
?
[Raw transfer]




PLP_B_4(1GD9)
?
[Raw transfer]




EPE_G_7(2DOU)
?
[Raw transfer]




PLP_A_12(1O4S)
AAT_THEMA
[Raw transfer]




PLP_B_4(1DJU)
?
[Raw transfer]




GLU_D_4(1GDE)
?
[Raw transfer]




GLU_C_3(1GDE)
?
[Raw transfer]




PLP_A_12(1O4S)
AAT_THEMA
[Raw transfer]




PLP_B_13(1O4S)
AAT_THEMA
[Raw transfer]




PLP_A_5(1B5O)
AAT_THET8
[Raw transfer]




PLP_E_5(1GCK)
AAT_THET8
[Raw transfer]




PLP_B_6(1B5P)
AAT_THET8
[Raw transfer]




PLP_A_3(1DJU)
?
[Raw transfer]




PLP_A_5(1B5P)
AAT_THET8
[Raw transfer]




PLP_A_3(1J32)
?
[Raw transfer]




PLP_B_4(1J32)
?
[Raw transfer]




PLP_B_6(5BJ4)
AAT_THET8
[Raw transfer]




PLP_B_6(1B5O)
AAT_THET8
[Raw transfer]




PLP_A_5(1B5P)
AAT_THET8
[Raw transfer]




ASP_C_3(1GCK)
AAT_THET8
[Raw transfer]




EDO_A_6(3EZS)
?
[Raw transfer]




EDO_A_4(3EZS)
?
[Raw transfer]




52 HHSearch 95.5242%-109 - C1 -1J32 4.8 ?
21 PsiBlast_CBE 94.3741%-110 - C1 -1J32 5.3 ?
1 PsiBlast_PDB 93.3841%-108 - C1 -1J32 - ? -
53 HHSearch 93.2341%-107 * C1 *1B5P 4.8 AAT_THET8
79 Fugue 91.3642%-114 - C1 -1BJW - AAT_THET8 -
12 PsiBlast_PDB 90.0537%-116 - C1 -1GDE 4.1 ?
2 PsiBlast_PDB 89.9341%-100 - C1 -1BKG - AAT_THET8 -
13 PsiBlast_PDB 89.6737%-117 - C1 -1GD9 3.7 ?
14 PsiBlast_PDB 89.6037%-118 - C1 -1DJU 3.6 ?
23 PsiBlast_CBE 89.4741%-101 - C1 -1BKG - AAT_THET8 -
24 PsiBlast_CBE 89.1541%-100 - C1 -1BKG - AAT_THET8 -
46 PsiBlast_CBE 89.0537%-118 - C1 -1DJU 3.8 ?
55 HHSearch 88.8538%-113 - C1 -1GD9 3.7 ?
22 PsiBlast_CBE 88.7941%-100 - C1 -1BKG - AAT_THET8 -
9 PsiBlast_PDB 87.7940%-103 - C1 -5BJ4 - AAT_THET8 -
6 PsiBlast_PDB 87.5841% -99 - C1 -1B5P 4.8 AAT_THET8
3 PsiBlast_PDB 87.1141%-101 - C1 -1B5O 4.9 AAT_THET8
28 PsiBlast_CBE 87.0641%-101 - C1 -1BJW - AAT_THET8 -
5 PsiBlast_PDB 86.8441% -98 - C1 -1GCK 5.5 AAT_THET8
26 PsiBlast_CBE 86.6841% -98 - C1 -1GCK 6.6 AAT_THET8
45 PsiBlast_CBE 86.5637%-116 - C1 -1GD9 3.8 ?
54 HHSearch 86.4738%-106 - C1 -1O4S 4.8 AAT_THEMA
44 PsiBlast_CBE 86.3737%-114 - C1 -1GDE 4.2 ?
29 PsiBlast_CBE 85.6840%-103 - C1 -5BJ4 5.1 AAT_THET8
43 PsiBlast_CBE 85.6738%-110 - C1 -1O4S 4.5 AAT_THEMA
27 PsiBlast_CBE 85.6541% -99 - C1 -1B5P 4.8 AAT_THET8
25 PsiBlast_CBE 85.3241%-100 - C1 -1B5O 5.3 AAT_THET8
11 PsiBlast_PDB 84.7938%-107 - C1 -1O4S 4.8 AAT_THEMA