Study : Wbm0023 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: ATP_A_7(4YMU) / Model_31(4YMU/A) = [4.6] Download478.875.71MGGNIALELTSISKSFKRNSAIIKGINLSVAKGQVVALIGSSGSGKTTILQIAGLLDKPTSGIVTIDGVNCTQASNKHKTHMRRSFLSFVYQFHYLLQELSVLENVILPQLIARKGKAEAINNAQAVLEKFGLENKASSMISEISGGERQRVAIARSIVNSPRLLLADEPTGNLDPTNSLNVFLLLYSYVKENNSSMLIVTHSHLLAEKADYILQLKDGSLVKL
Complex: ATP_A_6(4YMV) / Model_30(4YMV/A) = [4.8] Download864.573.47MGGNIALELTSISKSFKRNSAIIKGINLSVAKGQVVALIGSSGSGKTTILQIAGLLDKPTSGIVTIDGVNCTQASNKHKTHMRRSFLSFVYQFHYLLQELSVLENVILPQLIARKGKAEAINNAQAVLEKFGLENKASSMISEISGGERQRVAIARSIVNSPRLLLADEPTGNLDPTNSLNVFLLLYSYVKENNSSMLIVTHSHLLAEKADYILQLKDGSLVKL
Complex: ADP_A_2(4U00) / Model_46(4U00/A) = [5.0] Download786.124.21MGGNIALELTSISKSFKRNSAIIKGINLSVAKGQVVALIGSSGSGKTTILQIAGLLDKPTSGIVTIDGVNCTQASNKHKTHMRRSFLSFVYQFHYLLQELSVLENVILPQLIARKGKAEAINNAQAVLEKFGLENKASSMISEISGGERQRVAIARSIVNSPRLLLADEPTGNLDPTNSLNVFLLLYSYVKENNSSMLIVTHSHLLAEKADYILQLKDGSLVKL
Complex: AGS_B_6(3C4J) / Model_33(3C4J/B) = [5.1] Download1260.5611.72MGGNIALELTSISKSFKRNSAIIKGINLSVAKGQVVALIGSSGSGKTTILQIAGLLDKPTSGIVTIDGVNCTQASNKHKTHMRRSFLSFVYQFHYLLQELSVLENVILPQLIARKGKAEAINNAQAVLEKFGLENKASSMISEISGGERQRVAIARSIVNSPRLLLADEPTGNLDPTNSLNVFLLLYSYVKENNSSMLIVTHSHLLAEKADYILQLKDGSLVKL
Complex: ATP_J_5(4YMV) / Model_12(4YMV/J) = [5.1] Download828.844.06MGGNIALELTSISKSFKRNSAIIKGINLSVAKGQVVALIGSSGSGKTTILQIAGLLDKPTSGIVTIDGVNCTQASNKHKTHMRRSFLSFVYQFHYLLQELSVLENVILPQLIARKGKAEAINNAQAVLEKFGLENKASSMISEISGGERQRVAIARSIVNSPRLLLADEPTGNLDPTNSLNVFLLLYSYVKENNSSMLIVTHSHLLAEKADYILQLKDGSLVKL
Consensus
[pKd Mean = 4.92]
-843
(s=249)
5
(s=3)
MGGNIALELTSISKSFKRNSAIIKGINLSVAKGQVVALIGSSGSGKTTILQIAGLLDKPTSGIVTIDGVNCTQASNKHKTHMRRSFLSFVYQFHYLLQELSVLENVILPQLIARKGKAEAINNAQAVLEKFGLENKASSMISEISGGERQRVAIARSIVNSPRLLLADEPTGNLDPTNSLNVFLLLYSYVKENNSSMLIVTHSHLLAEKADYILQLKDGSLVKL