@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0023: (2015-11-27 )
MGGNIALELTSISKSFKRNSAIIKGINLSVAKGQVVALIGSSGSGKTTILQIAGLLDKPTSGIVTIDGVNCTQASNKHKTHMRRSFLSFVYQFHYLLQELSVLENVILPQLIARKGKAEAINNAQAVLEKFGLENKASSMISEISGGERQRVAIARSIVNSPRLLLADEPTGNLDPTNSLNVFLLLYSYVKENNSSMLIVTHSHLLAEKADYILQLKDGSLVKL

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_J_5(3C41)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ADP_A_3(1F3O)
Y796_METJA
[Raw transfer]




ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




78 HHSearch 93.5745%-108 - C1 -2PCJ - LOLD_AQUAE -
21 PsiBlast_CBE 92.9447%-106 - C1 -2PCJ - LOLD_AQUAE -
1 PsiBlast_PDB 91.7647%-104 - C1 -2PCJ - LOLD_AQUAE -
2 PsiBlast_PDB 89.6847%-102 - C1 -2PCL - LOLD_AQUAE -
81 HHSearch 87.6236%-109 - C1 -3TIF 6.1 Y796_METJA
4 PsiBlast_PDB 82.9937%-112 - C1 -1F3O 6.0 Y796_METJA
5 PsiBlast_PDB 82.1735%-105 - C1 -3TIF 6.1 Y796_METJA
22 PsiBlast_CBE 81.8836%-106 - C1 -1L2T 7.1 Y796_METJA
23 PsiBlast_CBE 81.7735%-109 - C1 -3TIF 6.3 Y796_METJA
33 PsiBlast_CBE 81.5435%-109 - C1 -3C4J 5.1 ?
3 PsiBlast_PDB 81.1936%-103 - C1 -1L2T 6.5 Y796_METJA
85 Fugue 79.9033%-107 - C1 -3TUZ - METN_ECOLI -
67 HHSearch 79.7132% -95 - C1 -2IT1 - ? -
83 HHSearch 79.4133%-110 * C1 *2OLJ 5.7 ?
17 PsiBlast_PDB 79.2235%-105 - C1 -2OLK 5.9 ?
32 PsiBlast_CBE 79.1335%-106 - C1 -3C41 5.7 ?
7 PsiBlast_PDB 79.0932%-101 - C1 -3TUI - METN_ECOLI -
8 PsiBlast_PDB 78.8832%-106 - C1 -3TUZ - METN_ECOLI -
38 PsiBlast_CBE 78.7435%-103 - C1 -2OLK 5.4 ?
18 PsiBlast_PDB 78.6835%-108 - C1 -2OUK - ? -
19 PsiBlast_PDB 78.4535%-107 - C1 -2Q0H 5.2 ?
15 PsiBlast_PDB 78.3535%-107 - C1 -3C41 5.6 ?
16 PsiBlast_PDB 78.3135%-107 - C1 -2OLJ 5.7 ?
40 PsiBlast_CBE 78.1935%-103 - C1 -2OLK 5.6 ?
20 PsiBlast_PDB 77.6335%-104 - C1 -3C4J 6.4 ?
31 PsiBlast_CBE 77.5337%-115 - C1 -4YMU 4.6 ?
39 PsiBlast_CBE 77.4635%-103 - C1 -2OLK 6.0 ?
41 PsiBlast_CBE 77.2935% -99 - C1 -2OLJ 5.3 ?
11 PsiBlast_PDB 76.1637%-111 - C1 -4YMU 5.2 ?
12 PsiBlast_PDB 75.7937%-111 - C1 -4YMV 5.1 ?
30 PsiBlast_CBE 75.0637%-110 - C1 -4YMV 4.8 ?
34 PsiBlast_CBE 75.0435%-106 - C1 -2Q0H 5.4 ?
46 PsiBlast_CBE 71.5933% -94 - C1 -4U00 5.0 ?