@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0028: (2015-11-27 )
MLKTFILIMNMENEKAHITKVKLPIFLDYQSTTKVDPRVLEMMIPYFSEFSNAHSRSHSFGWAAEEVVEKARRHIADLVNADSKEIIFTSGATESNNMAIKGVAHFYKNKGDHIITVCTEHKCVLDSCRHLENEGFKVTYLPVKRNGIIDLSKLEEAITDRTILVSVMMVNNEIGVIQPVKEIGAICRRHNVFFHTDAAQSFGKVPVDVNGMNIDLMSLTSHKVYGPMGIGALYVRRKSPRVRLTPLISGGGQERGMRSGTVPTPLAVGFGEAARIAKEEMKKEASKLEELRDILYNKIKEAFPDVVLNGDYNNRIPGNLNLSFPYVEGESLIMAIKDLAVSSGSACTSASLEPSYVIRSLNSGYDLEHSSIRFGLGRFTTKDEILYAADLIAKNVGRLREMSPLWEMVQEGIDLNTVKWDSH

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PLP_C_3(1ECX)
?
[Raw transfer]




PLP_A_3(3VAX)
?
[Raw transfer]




PLP_A_3(3VAX)
?
[Raw transfer]




PMP_A_5(4HVK)
ISCS2_ARCFU
[Raw transfer]




PLP_B_6(3LVJ)
ISCS_ECO57
[Raw transfer]




PLP_B_4(3VAX)
?
[Raw transfer]




PLP_A_3(3LVK)
ISCS_ECO57
[Raw transfer]




PLP_A_4(4EB7)
ISCS2_ARCFU
[Raw transfer]




PLP_B_8(4EB7)
ISCS2_ARCFU
[Raw transfer]




PLP_B_9(4EB5)
ISCS2_ARCFU
[Raw transfer]




PLP_A_6(1EG5)
?
[Raw transfer]




PLP_A_3(3A9Z)
SCLY_RAT
[Raw transfer]




PLP_A_6(1EG5)
?
[Raw transfer]




PLP_A_3(3A9X)
SCLY_RAT
[Raw transfer]




PLP_B_4(3A9X)
SCLY_RAT
[Raw transfer]




1 PsiBlast_PDB 96.3461% -97 - C3 -3LVJ - ISCS_ECO57 -
2 PsiBlast_PDB 95.5661% -95 - C3 -3LVK 3.3 ISCS_ECO57
21 PsiBlast_CBE 94.5761% -95 - C3 -3LVJ 3.4 ISCS_ECO57
11 PsiBlast_PDB 83.1731% -87 - C3 -3GZD - SCLY_HUMAN -
29 PsiBlast_CBE 82.7931% -85 - C3 -3GZC - SCLY_HUMAN -
10 PsiBlast_PDB 82.6431% -88 - C3 -3GZC - SCLY_HUMAN -
4 PsiBlast_PDB 82.2040% -87 - C3 -4EB7 2.8 ISCS2_ARCFU
3 PsiBlast_PDB 81.7340% -86 - C3 -4EB5 - ISCS2_ARCFU -
5 PsiBlast_PDB 81.6340% -87 - C3 -4HVK 3.3 ISCS2_ARCFU
89 HHSearch 81.2837% -91 * C3 *1EG5 3.6 ?
22 PsiBlast_CBE 80.7340% -88 - C3 -4EB7 3.0 ISCS2_ARCFU
77 Fugue 80.0435% -88 - C3 -1ECX 3.4 ?
23 PsiBlast_CBE 79.4540% -86 - C3 -4EB5 3.0 ISCS2_ARCFU
26 PsiBlast_CBE 79.3836% -91 - C3 -4ISY - ISCSL_MYCTU -
27 PsiBlast_CBE 79.3736% -87 - C3 -4ISY - ISCSL_MYCTU -
12 PsiBlast_PDB 78.1931% -94 - C3 -3A9X 4.5 SCLY_RAT
24 PsiBlast_CBE 78.0242% -88 - C3 -3VAX 3.4 ?
9 PsiBlast_PDB 78.0236% -90 - C3 -4ISY - ISCSL_MYCTU -
25 PsiBlast_CBE 77.8236% -88 - C3 -1ECX - ? -
31 PsiBlast_CBE 77.4031% -91 - C3 -3A9Y - SCLY_RAT -
8 PsiBlast_PDB 76.9135% -89 - C3 -1EG5 3.6 ?
93 HHSearch 76.7831% -81 - C3 -3A9Z 4.3 SCLY_RAT
6 PsiBlast_PDB 76.4742% -87 - C3 -3VAX 3.3 ?
32 PsiBlast_CBE 76.3231% -87 - C3 -3A9X 4.4 SCLY_RAT
91 HHSearch 75.7040% -83 - C3 -3VAX 3.3 ?