@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0046: (2015-11-28 )
MEIILAEPRGFCAGVKRAVDILAITLKKYRNKRKVYVLHEIVHNKYIVEDFKRQGVIFVNSIRDIKDNRGILIFSAHGVSKNIEDKAKRKGIQVIDATCPLVSKVHKEAKRYEDSGKELILIGHKNHPEVKGIRGRVNNPIVLVQTLQNVRDLKVKNPDNLSYVTQTTLSTDDTREIITALKLRFPNITGPNLKDICYATQNRQNAVKKLTEIVDIVLIIGSKNSSNSNRLLDLCTARGKRAYLIDNYSYMDKSWLQGIEKIGITAGASAPDILVDELINHLKINVNTKVSVMSDGVTENVQFKIPHLV

Atome Classification :

(60 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0CH_A_4(3UV6)
ISPH_ECOLI
[Raw transfer]




0O3_B_6(4EB3)
ISPH_ECOLI
[Raw transfer]




0K2_B_7(3UWM)
ISPH_ECOLI
[Raw transfer]




2E5_B_6(4MUY)
?
[Raw transfer]




0K2_A_4(3UWM)
ISPH_ECOLI
[Raw transfer]




2E4_A_4(4MUX)
?
[Raw transfer]




2E6_A_4(4MV0)
?
[Raw transfer]




0CH_B_6(3UV6)
ISPH_ECOLI
[Raw transfer]




0CM_A_4(3UV3)
ISPH_ECOLI
[Raw transfer]




2E5_A_4(4MUY)
?
[Raw transfer]




0JX_A_4(3UTC)
ISPH_ECOLI
[Raw transfer]




0O3_A_4(4EB3)
ISPH_ECOLI
[Raw transfer]




10E_A_4(4H4D)
ISPH_ECOLI
[Raw transfer]




0CM_B_6(3UV3)
ISPH_ECOLI
[Raw transfer]




0CN_A_4(3UV7)
ISPH_ECOLI
[Raw transfer]




2E7_A_4(4MV5)
?
[Raw transfer]




DMA_A_4(3KEF)
ISPH_ECOLI
[Raw transfer]




0CG_B_6(3URK)
ISPH_ECOLI
[Raw transfer]




0CG_A_4(3URK)
ISPH_ECOLI
[Raw transfer]




10G_A_3(3ZGN)
ISPH_ECOLI
[Raw transfer]




2E7_B_6(4MV5)
?
[Raw transfer]




10D_A_4(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_A_4(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4MUX)
?
[Raw transfer]




SF4_A_3(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_B_6(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4MUX)
?
[Raw transfer]




SF4_A_3(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3ZGL)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_A_4(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MV0)
?
[Raw transfer]




F3S_B_5(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MUY)
?
[Raw transfer]




F3S_B_5(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_B_9(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_B_6(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MUY)
?
[Raw transfer]




F3S_B_5(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MV0)
?
[Raw transfer]




F3S_B_5(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_B_4(3DNF)
ISPH_AQUAE
[Raw transfer]




5 PsiBlast_PDB 97.3248%-106 - C10 -4MV5 6.3 ?
3 PsiBlast_PDB 97.0248%-104 - C10 -4MV0 5.5 ?
39 PsiBlast_CBE 97.0048%-103 - C10 -3UWM 4.6 ISPH_ECOLI
26 PsiBlast_CBE 96.7848%-103 - C10 -3SZO 3.8 ISPH_ECOLI
20 PsiBlast_PDB 96.7748%-103 - C10 -3UTC 5.5 ISPH_ECOLI
1 PsiBlast_PDB 96.7548%-105 - C10 -4EB3 5.0 ISPH_ECOLI
42 PsiBlast_CBE 96.7148%-100 - C10 -3UV7 5.3 ISPH_ECOLI
25 PsiBlast_CBE 96.6748%-103 - C10 -4EB3 4.9 ISPH_ECOLI
48 PsiBlast_CBE 96.6448%-100 - C10 -3UTD 3.9 ISPH_ECOLI
36 PsiBlast_CBE 96.5948%-104 - C10 -4H4E 3.8 ISPH_ECOLI
27 PsiBlast_CBE 96.5148%-105 - C10 -3SZL 3.8 ISPH_ECOLI
33 PsiBlast_CBE 96.4848%-105 - C10 -3KE8 3.8 ISPH_ECOLI
31 PsiBlast_CBE 96.4748%-102 - C10 -3KEF 3.5 ISPH_ECOLI
34 PsiBlast_CBE 96.4548%-104 - C10 -3ZGN 3.7 ISPH_ECOLI
45 PsiBlast_CBE 96.3848%-104 - C10 -3UV3 5.5 ISPH_ECOLI
11 PsiBlast_PDB 96.3648%-102 - C10 -3KEF 5.0 ISPH_ECOLI
46 PsiBlast_CBE 96.3348%-101 - C10 -3UV3 5.6 ISPH_ECOLI
22 PsiBlast_CBE 96.3348%-106 - C10 -4MV0 3.8 ?
47 PsiBlast_CBE 96.2648%-105 - C10 -3UTD 3.9 ISPH_ECOLI
19 PsiBlast_PDB 96.2648%-101 - C10 -3URK 5.2 ISPH_ECOLI
53 PsiBlast_CBE 96.2548%-111 - C10 -3T0F 3.8 ISPH_ECOLI
56 PsiBlast_CBE 96.1748%-101 * C10 *3T0G 3.8 ISPH_ECOLI
44 PsiBlast_CBE 96.1748%-102 - C10 -3UV6 5.8 ISPH_ECOLI
2 PsiBlast_PDB 96.1548%-102 - C10 -4MUY 5.6 ?
13 PsiBlast_PDB 96.1448%-104 - C10 -3KEM 3.6 ISPH_ECOLI
21 PsiBlast_CBE 96.1348%-106 - C10 -4MV5 6.2 ?
43 PsiBlast_CBE 96.0848%-103 - C10 -3UV6 5.6 ISPH_ECOLI
52 PsiBlast_CBE 96.0048% -99 - C10 -3SZU 3.8 ISPH_ECOLI
16 PsiBlast_PDB 96.0048%-101 - C10 -4H4C 5.2 ISPH_ECOLI
41 PsiBlast_CBE 95.9848%-103 - C10 -3UV7 3.9 ISPH_ECOLI
40 PsiBlast_CBE 95.9548%-102 - C10 -3UWM 4.7 ISPH_ECOLI
32 PsiBlast_CBE 95.9348%-104 - C10 -3KE9 3.8 ISPH_ECOLI
4 PsiBlast_PDB 95.9048%-103 - C10 -4MUX 5.6 ?
29 PsiBlast_CBE 95.8948%-103 - C10 -3KEM 3.5 ISPH_ECOLI
30 PsiBlast_CBE 95.8548%-103 - C10 -3KEL 3.6 ISPH_ECOLI
10 PsiBlast_PDB 95.8348%-104 - C10 -3KE9 3.8 ISPH_ECOLI
18 PsiBlast_PDB 95.7648%-103 - C10 -4H4E 3.8 ISPH_ECOLI
49 PsiBlast_CBE 95.7248%-104 - C10 -3UTC 3.8 ISPH_ECOLI
6 PsiBlast_PDB 95.7048%-102 - C10 -3F7T 3.4 ISPH_ECOLI
23 PsiBlast_CBE 95.6748%-104 - C10 -4MUY 5.7 ?
24 PsiBlast_CBE 95.6548%-104 - C10 -4MUX 3.8 ?
55 PsiBlast_CBE 95.6448%-104 - C10 -3T0G 3.8 ISPH_ECOLI
35 PsiBlast_CBE 95.6148%-103 - C10 -3ZGL 3.8 ISPH_ECOLI
7 PsiBlast_PDB 95.5848%-102 - C10 -3SZL 3.8 ISPH_ECOLI
28 PsiBlast_CBE 95.5648%-103 - C10 -3F7T 3.3 ISPH_ECOLI
51 PsiBlast_CBE 95.4348%-102 - C10 -3SZU 3.8 ISPH_ECOLI
17 PsiBlast_PDB 95.4348%-100 - C10 -4H4D 5.9 ISPH_ECOLI
12 PsiBlast_PDB 95.4348%-103 - C10 -3KEL 3.6 ISPH_ECOLI
54 PsiBlast_CBE 95.3648%-105 - C10 -3T0F 3.8 ISPH_ECOLI
15 PsiBlast_PDB 95.3648%-103 - C10 -3ZGN 5.4 ISPH_ECOLI
37 PsiBlast_CBE 95.3548%-104 - C10 -4H4D 3.8 ISPH_ECOLI
9 PsiBlast_PDB 95.2748%-100 - C10 -3KE8 3.8 ISPH_ECOLI
38 PsiBlast_CBE 95.0548%-102 - C10 -4H4C 3.9 ISPH_ECOLI
50 PsiBlast_CBE 94.9848%-102 - C10 -3URK 5.0 ISPH_ECOLI
8 PsiBlast_PDB 94.4648%-100 - C10 -3SZO 3.8 ISPH_ECOLI
14 PsiBlast_PDB 94.2348%-100 - C10 -3ZGL 3.8 ISPH_ECOLI
59 Fugue 78.9935%-100 - C10 -3DNF 3.7 ISPH_AQUAE
68 HHSearch 78.4634% -96 - C10 -3DNF 3.7 ISPH_AQUAE
57 PsiBlast_CBE 75.8735% -89 - C10 -3DNF 3.7 ISPH_AQUAE
58 PsiBlast_CBE 75.3735% -88 - C10 -3DNF 3.7 ISPH_AQUAE