Study : Wbm0049 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C8_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C8_S1
Complex: ACY_A_9(1JPN) / Model_10(1JPN/A) = [3.2] Download92.1628.58MFKSLTESLNSVFNKLKGKSIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKVIKSVSPAQMIIKVVQDNLITILGLEKSDLNLGANPPAVIMMVGLQGAGKTTTSGKLALKLKKQKKKVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDEKPTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELKTVKKIASPAEVILVADAMIGQDAVNIAKSFNETIGVTGIILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEEFDKLQKKVKKGRLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGVPDDSKVKKYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK
Complex: GCP_B_6(1RJ9) / Model_115(1RJ9/A) = [3.4] Download1277.3617.64MFKSLTESLNSVFNKLKGKSIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKVIKSVSPAQMIIKVVQDNLITILGLEKSDLNLGANPPAVIMMVGLQGAGKTTTSGKLALKLKKQKKKVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDEKPTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELKTVKKIASPAEVILVADAMIGQDAVNIAKSFNETIGVTGIILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEEFDKLQKKVKKGRLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGVPDDSKVKKYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK
Complex: ACY_B_7(1JPN) / Model_30(1JPN/B) = [3.6] Download129.8734.08MFKSLTESLNSVFNKLKGKSIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKVIKSVSPAQMIIKVVQDNLITILGLEKSDLNLGANPPAVIMMVGLQGAGKTTTSGKLALKLKKQKKKVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDEKPTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELKTVKKIASPAEVILVADAMIGQDAVNIAKSFNETIGVTGIILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEEFDKLQKKVKKGRLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGVPDDSKVKKYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK
Complex: GOL_B_14(3DMD) / Model_39(3DMD/B) = [3.7] Download812.954.83MFKSLTESLNSVFNKLKGKSIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKVIKSVSPAQMIIKVVQDNLITILGLEKSDLNLGANPPAVIMMVGLQGAGKTTTSGKLALKLKKQKKKVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDEKPTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELKTVKKIASPAEVILVADAMIGQDAVNIAKSFNETIGVTGIILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEEFDKLQKKVKKGRLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGVPDDSKVKKYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK
Complex: EDO_B_14(3NG1) / Model_31(3NG1/B) = [3.8] Download102.3228.58MFKSLTESLNSVFNKLKGKSIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKVIKSVSPAQMIIKVVQDNLITILGLEKSDLNLGANPPAVIMMVGLQGAGKTTTSGKLALKLKKQKKKVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDEKPTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELKTVKKIASPAEVILVADAMIGQDAVNIAKSFNETIGVTGIILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEEFDKLQKKVKKGRLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGVPDDSKVKKYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK
Consensus
[pKd Mean = 3.54]
-482
(s=482)
22
(s=10)
MFKSLTESLNSVFNKLKGKSIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKVIKSVSPAQMIIKVVQDNLITILGLEKSDLNLGANPPAVIMMVGLQGAGKTTTSGKLALKLKKQKKKVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDEKPTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELKTVKKIASPAEVILVADAMIGQDAVNIAKSFNETIGVTGIILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEEFDKLQKKVKKGRLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGVPDDSKVKKYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK