@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0049: (2015-11-28 )
MFKSLTESLNSVFNKLKGKSIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKVIKSVSPAQMIIKVVQDNLITILGLEKSDLNLGANPPAVIMMVGLQGAGKTTTSGKLALKLKKQKKKVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDEKPTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELKTVKKIASPAEVILVADAMIGQDAVNIAKSFNETIGVTGIILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEEFDKLQKKVKKGRLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGVPDDSKVKKYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK

Atome Classification :

(47 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GDP_B_11(4C7O)
FTSY_ECOLI
[Raw transfer]




GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GCP_B_6(1RJ9)
SRP54_THEAQ
[Raw transfer]




GDP_A_6(1O87)
SRP54_THEAQ
[Raw transfer]




GNP_A_12(2J7P)
SRP54_THEAQ
[Raw transfer]




GNP_B_20(2J7P)
SRP54_THEAQ
[Raw transfer]




GDP_D_17(4C7O)
FTSY_ECOLI
[Raw transfer]




GNP_A_6(1JPN)
SRP54_THEAQ
[Raw transfer]




GNP_B_5(1JPN)
SRP54_THEAQ
[Raw transfer]




GNP_B_2(1JPJ)
SRP54_THEAQ
[Raw transfer]




GDP_B_12(1O87)
SRP54_THEAQ
[Raw transfer]




GDP_B_2(2NG1)
SRP54_THEAQ
[Raw transfer]




CIT_B_4(1VMA)
?
[Raw transfer]




GDP_C_2(3E70)
?
[Raw transfer]




GDP_C_2(3E70)
?
[Raw transfer]




GDP_A_7(1NG1)
SRP54_THEAQ
[Raw transfer]




GCP_A_5(1RJ9)
SRP54_THEAQ
[Raw transfer]




GNP_K_11(2Q9C)
FTSY_THEAQ
[Raw transfer]




GCP_D_17(1OKK)
FTSY_THEAQ
[Raw transfer]




GCP_D_17(1OKK)
SRP54_THEAQ
[Raw transfer]




GDP_B_11(4C7O)
SRP54_ECOLI
[Raw transfer]




GDP_D_17(4C7O)
SRP54_ECOLI
[Raw transfer]




GOL_B_14(3DMD)
?
[Raw transfer]




GNP_T_20(2Q9B)
FTSY_THEAQ
[Raw transfer]




FMT_B_11(1O87)
SRP54_THEAQ
[Raw transfer]




GDP_D_2(2IYL)
FTSY_THEAQ
[Raw transfer]




EDO_B_13(3NG1)
SRP54_THEAQ
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




EDO_A_6(2J7P)
SRP54_THEAQ
[Raw transfer]




ACY_B_7(1JPN)
SRP54_THEAQ
[Raw transfer]




GDP_D_18(4C7O)
SRP54_ECOLI
[Raw transfer]




EDO_A_12(3NG1)
SRP54_THEAQ
[Raw transfer]




EDO_A_2(2YHS)
FTSY_ECOLI
[Raw transfer]




EDO_B_14(3NG1)
SRP54_THEAQ
[Raw transfer]




GNP_B_20(2J7P)
FTSY_THEAQ
[Raw transfer]




EDO_A_2(2YHS)
FTSY_ECOLI
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




ACY_A_9(1JPN)
SRP54_THEAQ
[Raw transfer]




GNP_A_12(2J7P)
FTSY_THEAQ
[Raw transfer]




1 PsiBlast_PDB 90.1047% -94 - C8 -2XXA - SRP54_ECOLI -
21 PsiBlast_CBE 89.8047% -98 - C8 -2XXA - SRP54_ECOLI -
22 PsiBlast_CBE 85.8941% -93 - C8 -2FFH - SRP54_THEAQ -
23 PsiBlast_CBE 85.6641% -93 - C8 -2FFH - SRP54_THEAQ -
98 HHSearch 85.2634% -94 - C8 -3DM5 Error SRP54_PYRFU
2 PsiBlast_PDB 85.2641% -94 - C8 -2FFH - SRP54_THEAQ -
36 PsiBlast_CBE 85.1534% -93 - C8 -3DM5 Error SRP54_PYRFU
100 HHSearch 84.2841% -90 - C8 -2FFH - SRP54_THEAQ -
24 PsiBlast_CBE 84.1850%-100 - C8 -4C7O 4.0 SRP54_ECOLI
97 HHSearch 83.5047% -17 - C- -2XXA - SRP54_ECOLI -
35 PsiBlast_CBE 83.4834% -94 - C8 -3DM5 7.0 SRP54_PYRFU
4 PsiBlast_PDB 83.2050%-102 - C8 -4C7O 2.4 SRP54_ECOLI
6 PsiBlast_PDB 82.1538% -97 - C8 -3NDB - SRP54_METJA -
25 PsiBlast_CBE 81.1243%-114 - C8 -2J46 - SRP54_THEAQ -
27 PsiBlast_CBE 80.6243%-112 - C8 -2C04 - SRP54_THEAQ -
29 PsiBlast_CBE 80.3843%-113 - C8 -2C03 - SRP54_THEAQ -
34 PsiBlast_CBE 80.3542%-105 - C8 -2CNW - SRP54_THEAQ -
11 PsiBlast_PDB 80.3043%-108 - C8 -1RY1 - SRP54_THEAQ -
10 PsiBlast_PDB 80.2843%-108 - C8 -1JPN 6.9 SRP54_THEAQ
30 PsiBlast_CBE 80.1643%-108 - C8 -1JPN 6.3 SRP54_THEAQ
15 PsiBlast_PDB 79.9742%-108 - C8 -2J7P 9.1 SRP54_THEAQ
9 PsiBlast_PDB 79.9143%-108 - C8 -1JPJ 7.5 SRP54_THEAQ
31 PsiBlast_CBE 79.5042%-108 - C8 -3NG1 3.8 SRP54_THEAQ
12 PsiBlast_PDB 79.4742%-108 - C8 -3NG1 3.8 SRP54_THEAQ
28 PsiBlast_CBE 79.3443%-102 - C8 -1O87 6.7 SRP54_THEAQ
32 PsiBlast_CBE 79.2742%-111 - C8 -2J7P 9.2 SRP54_THEAQ
16 PsiBlast_PDB 78.8842%-103 - C8 -1NG1 6.7 SRP54_THEAQ
8 PsiBlast_PDB 78.7643%-104 - C8 -1O87 7.1 SRP54_THEAQ
13 PsiBlast_PDB 78.4942%-110 - C8 -1OKK 2.9 SRP54_THEAQ
20 PsiBlast_PDB 77.3442%-104 - C8 -2NG1 5.3 SRP54_THEAQ
5 PsiBlast_PDB 76.7143%-101 - C8 -1RJ9 9.1 SRP54_THEAQ
108 HHSearch 72.4837%-101 - C8 -3E70 7.2 ?
111 HHSearch 70.8437% -98 - C8 -2YHS 2.9 FTSY_ECOLI
39 PsiBlast_CBE 69.9438% -99 - C8 -3DMD 3.7 ?
115 HHSearch 69.7133%-108 - C8 -1RJ9 3.4 FTSY_THEAQ
37 PsiBlast_CBE 68.6138% -97 - C8 -3E70 7.2 ?
43 PsiBlast_CBE 66.7238% -87 - C8 -4C7O 7.5 FTSY_ECOLI
44 PsiBlast_CBE 66.2938% -85 - C8 -4C7O 6.5 FTSY_ECOLI
45 PsiBlast_CBE 65.1738% -85 - C8 -2YHS 2.9 FTSY_ECOLI
48 PsiBlast_CBE 63.2742% -85 - C8 -1VMA 4.0 ?
58 PsiBlast_CBE 61.6839% -78 - C8 -1OKK 7.3 FTSY_THEAQ
57 PsiBlast_CBE 61.0239% -76 - C8 -2J7P 2.2 FTSY_THEAQ
56 PsiBlast_CBE 60.0739% -76 - C8 -2J7P 2.9 FTSY_THEAQ
64 PsiBlast_CBE 58.8938% -75 - C8 -1RJ9 2.9 FTSY_THEAQ
59 PsiBlast_CBE 57.8139% -79 - C8 -2IYL 5.0 FTSY_THEAQ
53 PsiBlast_CBE 56.2539% -77 - C8 -2Q9B 5.5 FTSY_THEAQ
51 PsiBlast_CBE 56.1939% -73 - C8 -2Q9C 6.6 FTSY_THEAQ