@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0073: (2015-11-28 )
MTIIIDGKKIASGLCEKLSQRIDVLKREHSIFPCLKVIFVGNNPASQVYVRNKQKKAESIGISSETIVLPDNILENELIEKINELNNDRFVNGILVQLPLPNHINASKVINTVSVEKDVDAFHRENVGKLVKGEKNCLVPCTPKGALHLIKLVETNLSGKNAVVIGRSNIVGKPMFHLLLQENCTVTILHSQSKDLAEYCSKADVVVTAVGKPNFVQEGWIKEGAIVIDVGINSVSIEGKTKLIGDVDFDRVKEKTKAITPVPGGVGPMTIAFLMINTVIAACLQKKVDASDFVS

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

L34_B_9(4B4V)
?
[Raw transfer]




9L9_A_6(4B4W)
?
[Raw transfer]




9L9_B_9(4B4W)
?
[Raw transfer]




NDP_C_3(1A4I)
C1TC_HUMAN
[Raw transfer]




9L9_B_7(4CJX)
?
[Raw transfer]




NDP_C_3(1A4I)
C1TC_HUMAN
[Raw transfer]




L34_E_5(1DIB)
C1TC_HUMAN
[Raw transfer]




NDP_C_3(1A4I)
C1TC_HUMAN
[Raw transfer]




NAP_A_4(1DIG)
C1TC_HUMAN
[Raw transfer]




NAP_A_3(1DIA)
C1TC_HUMAN
[Raw transfer]




NAP_D_4(1DIB)
C1TC_HUMAN
[Raw transfer]




9L9_A_5(4CJX)
?
[Raw transfer]




NAP_C_3(1DIB)
C1TC_HUMAN
[Raw transfer]




NAP_A_3(3NGL)
FOLD_THEAC
[Raw transfer]




L37_A_6(1DIG)
C1TC_HUMAN
[Raw transfer]




NDP_D_4(1A4I)
C1TC_HUMAN
[Raw transfer]




L24_A_5(1DIA)
C1TC_HUMAN
[Raw transfer]




NAP_C_4(3NGL)
FOLD_THEAC
[Raw transfer]




NAP_B_5(1DIG)
C1TC_HUMAN
[Raw transfer]




NAP_B_4(1DIA)
C1TC_HUMAN
[Raw transfer]




NAD_A_3(3P2O)
FOLD_CAMJE
[Raw transfer]




NAD_A_3(3P2O)
FOLD_CAMJE
[Raw transfer]




EDO_B_14(4B4U)
?
[Raw transfer]




NAP_B_7(4B4V)
?
[Raw transfer]




NAP_B_7(4B4W)
?
[Raw transfer]




EDO_A_7(4B4U)
?
[Raw transfer]




NAP_A_3(4B4V)
?
[Raw transfer]




NAP_A_3(4B4U)
?
[Raw transfer]




NAP_B_10(4B4U)
?
[Raw transfer]




NAP_A_3(4B4W)
?
[Raw transfer]




IMD_B_7(3L07)
FOLD_FRATT
[Raw transfer]




IMD_A_4(3L07)
FOLD_FRATT
[Raw transfer]




21 PsiBlast_CBE 96.7349%-117 - C7 -3L07 3.7 FOLD_FRATT
1 PsiBlast_PDB 96.3749%-118 - C7 -3L07 - FOLD_FRATT -
5 PsiBlast_PDB 95.7447%-116 - C7 -1DIA 9.0 C1TC_HUMAN
35 HHSearch 95.4750%-114 - C7 -3L07 3.8 FOLD_FRATT
7 PsiBlast_PDB 95.2147%-114 - C7 -1DIG 9.1 C1TC_HUMAN
23 PsiBlast_CBE 94.5147%-112 - C7 -1DIB 8.8 C1TC_HUMAN
22 PsiBlast_CBE 94.5147%-114 - C7 -1DIG 8.7 C1TC_HUMAN
6 PsiBlast_PDB 94.4847%-113 - C7 -1DIB 9.3 C1TC_HUMAN
55 Fugue 94.4147%-110 * C7 *1A4I 10.1 C1TC_HUMAN
24 PsiBlast_CBE 94.1747%-112 - C7 -1DIA 9.1 C1TC_HUMAN
25 PsiBlast_CBE 94.1647%-110 - C7 -1A4I 9.6 C1TC_HUMAN
37 HHSearch 94.0648%-115 - C7 -3P2O 7.3 FOLD_CAMJE
8 PsiBlast_PDB 93.8347%-112 - C7 -1A4I 10.1 C1TC_HUMAN
36 HHSearch 92.8145%-110 - C7 -1A4I 10.1 C1TC_HUMAN
3 PsiBlast_PDB 92.6347%-115 - C7 -3P2O 7.3 FOLD_CAMJE
4 PsiBlast_PDB 92.1846%-111 - C7 -1B0A - FOLD_ECOLI -
26 PsiBlast_CBE 90.7943%-115 - C7 -4A26 - ? -
39 HHSearch 90.7446%-110 - C7 -1B0A - FOLD_ECOLI -
29 PsiBlast_CBE 90.3139%-117 - C7 -4B4U 6.4 ?
30 PsiBlast_CBE 90.0437%-114 - C7 -4CJX 6.2 ?
27 PsiBlast_CBE 89.9639%-116 - C7 -4B4W 6.1 ?
28 PsiBlast_CBE 89.9239%-117 - C7 -4B4V 6.0 ?
11 PsiBlast_PDB 89.7339%-119 - C7 -4B4V 6.6 ?
12 PsiBlast_PDB 89.2839%-115 - C7 -4B4W 6.1 ?
13 PsiBlast_PDB 89.0837%-113 - C7 -4CJX 6.4 ?
10 PsiBlast_PDB 88.7939%-114 - C7 -4B4U 6.7 ?
16 PsiBlast_PDB 82.4735%-120 - C7 -3NGL 9.2 FOLD_THEAC
31 PsiBlast_CBE 81.8635%-119 - C7 -3NGL 9.4 FOLD_THEAC