@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0078: (2015-11-28 )
MIRGIGTDIVYIPRILRILQKYGKKFLNKIYTEQEIEISRKYNSQEMQAKYLAKRFAAKEAFVKALGGFSHGIIMKDIEIYNDVRGKPHLTVSKNFIFKDHMIHLSLSDDGDCATAFVIICSSLP

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

A3P_C_24(3HYK)
ACPS_BACAN
[Raw transfer]




A3P_D_4(1FTH)
ACPS_STRPN
[Raw transfer]




A3P_A_9(3HYK)
ACPS_BACAN
[Raw transfer]




42 HHSearch 95.1243%-126 - C5 -3QMN - ACPS_VIBCH -
1 PsiBlast_PDB 90.4740%-121 - C5 -3QMN - ACPS_VIBCH -
4 PsiBlast_PDB 84.3833%-150 - C5 -4JM7 - ACPS_STAAC -
34 PsiBlast_CBE 83.5840%-117 - C5 -5CMO - ? -
45 HHSearch 82.7042%-136 * C5 *3HYK 4.9 ACPS_BACAN
2 PsiBlast_PDB 81.8933%-144 - C5 -5CXD - ? -
25 PsiBlast_CBE 81.3433%-137 - C5 -4DXE - ACPS_STAAC -
23 PsiBlast_CBE 80.4633%-140 - C5 -4DXE - ACPS_STAAC -
12 PsiBlast_PDB 79.9736%-132 - C5 -1F7T - ACPS_BACSU -
31 PsiBlast_CBE 79.6736%-136 - C5 -1F7T - ACPS_BACSU -
30 PsiBlast_CBE 79.5636%-132 - C5 -1F7T - ACPS_BACSU -
29 PsiBlast_CBE 79.2536%-134 - C5 -1F7T - ACPS_BACSU -
3 PsiBlast_PDB 78.8933%-128 - C5 -4DXE - ACPS_STAAC -
43 HHSearch 78.7636%-132 - C5 -1F7L - ACPS_BACSU -
11 PsiBlast_PDB 78.4336%-136 - C5 -1F7L - ACPS_BACSU -
13 PsiBlast_PDB 78.2536%-123 - C5 -1F80 - ACPS_BACSU -
33 PsiBlast_CBE 77.6836%-115 - C5 -1F80 - ACPS_BACSU -
32 PsiBlast_CBE 77.6436%-133 - C5 -1F7T - ACPS_BACSU -
21 PsiBlast_CBE 77.6333%-133 - C5 -5CXD - ? -
24 PsiBlast_CBE 76.9633%-129 - C5 -4DXE - ACPS_STAAC -
46 HHSearch 76.8434%-111 - C5 -1FTH 3.1 ACPS_STRPN