@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0083: (2015-11-28 )
MFKGIITNIGTIINTTIRSNSDQIFHIKAQNLSSIHEGDSIACSGVCLTVVDIINDIFTVQISQETMKVSNLGAWKVGKKINLEQAMRLSDKIDGHLVHGHVDETAKILTINQNLGSHEIKLSCPQELIKFVAKKGSVTLDGVSLTVNSVIGREFTVNIIPYTWQNTTFQYNKVNDYLNLEVDMIARYLDQLIQYKYN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

INI_B_6(4GQN)
?
[Raw transfer]




INI_C_8(4GQN)
?
[Raw transfer]




RBF_A_4(4E0F)
?
[Raw transfer]




RS3_C_7(4G6I)
?
[Raw transfer]




RS3_B_6(4G6I)
?
[Raw transfer]




RS3_A_4(4G6I)
?
[Raw transfer]




CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




INI_B_7(4GQN)
?
[Raw transfer]




25 PsiBlast_CBE 93.5141% -94 - C3 -4E0F - ? -
1 PsiBlast_PDB 93.3141%-103 - C3 -4E0F 6.0 ?
3 PsiBlast_PDB 92.8541%-100 - C3 -4G6I 6.6 ?
2 PsiBlast_PDB 92.4641% -98 - C3 -4FXU - ? -
22 PsiBlast_CBE 92.0641% -95 - C3 -4GQN 5.4 ?
24 PsiBlast_CBE 91.9641% -97 - C3 -4G6I 7.0 ?
21 PsiBlast_CBE 91.4341%-101 - C3 -4GQN 4.4 ?
4 PsiBlast_PDB 90.8241%-100 - C3 -4GQN 2.5 ?
23 PsiBlast_CBE 89.9541% -94 - C3 -4G6I 6.9 ?
29 HHSearch 89.5835% -99 - C3 -1KZL 6.0 RISA_SCHPO
5 PsiBlast_PDB 85.8635% -94 - C3 -1KZL 6.0 RISA_SCHPO
41 Fugue 85.0830% -94 - C3 -1I8D - RISA_ECOLI -
30 HHSearch 84.8931% -93 - C3 -1I8D - RISA_ECOLI -
6 PsiBlast_PDB 82.3832% -91 - C3 -1I8D - RISA_ECOLI -
32 HHSearch 70.2220% -84 - C3 -3DDY - LUXP_PHOLE -
31 HHSearch 69.9322% -92 - C3 -3A35 - ? -
9 PsiBlast_PDB 69.4024%-101 - C3 -3A3B - ? -
42 Fugue 66.9232%-106 - C3 -1KZL 2.4 RISA_SCHPO
33 HHSearch 66.1024%-107 - C3 -1I8D - RISA_ECOLI -
8 PsiBlast_PDB 65.3224%-102 - C3 -3A35 - ? -