@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0093: (2015-11-28 )
MHLIVGLGNPGSQYELTYHNIGFIIVDAICKHWNFQSFSKKADCLITSSVINDNKIMLMKPYSFMNNSGIPVARIRNFYKFSLDNVIVIHDDADLEPGRIKIKKGGGSAGHNGLKSIDSSIGNDYWRLRFGIGRSDSQRSLADYVLSKFSNLDDVIPLVERIAQNIHLMLQGNNIAFTNSIV

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

URI_A_2(4JX9)
?
[Raw transfer]




TLA_A_3(4OLJ)
?
[Raw transfer]




CTN_A_2(4JWK)
?
[Raw transfer]




EDO_A_4(3NEA)
PTH_FRATT
[Raw transfer]




1 PsiBlast_PDB 97.2138%-126 - C2 -4QT4 - PTH_STRPZ -
43 Fugue 96.8236%-124 - C2 -4QT4 - PTH_STRPZ -
9 PsiBlast_PDB 94.6836%-120 - C2 -3TD2 - PTH_MYCTU -
52 HHSearch 94.1835%-113 - C2 -3NEA 3.0 PTH_FRATT
8 PsiBlast_PDB 94.1836%-120 - C2 -3TCN - PTH_MYCTU -
7 PsiBlast_PDB 93.9836%-118 - C2 -3TCK - PTH_MYCTU -
56 HHSearch 93.9633%-115 - C2 -3V2I - PTH_BURTA -
10 PsiBlast_PDB 93.5536%-114 - C2 -3TD6 - PTH_MYCTU -
4 PsiBlast_PDB 93.5436%-117 - C2 -2Z2I - PTH_MYCTU -
6 PsiBlast_PDB 92.7136%-117 - C2 -2Z2K - PTH_MYCTU -
23 PsiBlast_CBE 92.5733%-113 - C2 -4JX9 4.1 ?
5 PsiBlast_PDB 92.5536%-116 - C2 -2Z2J - PTH_MYCTU -
18 PsiBlast_PDB 92.5133%-113 - C2 -4LWQ - ? -
19 PsiBlast_PDB 92.4933%-111 - C2 -4LWR - ? -
26 PsiBlast_CBE 92.4033%-114 - C2 -4HOY - ? -
24 PsiBlast_CBE 92.2433%-118 - C2 -4JWK 3.5 ?
12 PsiBlast_PDB 92.2035%-118 - C2 -3KJZ - PTH_MYCS2 -
20 PsiBlast_PDB 92.0133%-112 - C2 -3WH4 - ? -
51 HHSearch 91.9735%-115 * C2 *2Z2I - PTH_MYCTU -
27 PsiBlast_CBE 91.8933%-115 - C2 -4FOT - ? -
21 PsiBlast_CBE 91.2833%-113 - C2 -4OLJ 2.7 ?