@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0112: (2015-11-28 )
MSITLHSQKDFEFMRKAGRLAAETLDFIAPYVKVGVTTNKLNDLCHDFIVKAGAIPAPLNYKGYPKSICTSKNAVVCHGIPDDKPLKDGDILNIDVTVILNGWYGDTSRMFWAGKPSIKAKRLCDATYVALMEAIKQVKPGNKLNEIGLAVEKYIRDFGYSIVRSYCGHGIGKVFHAPPNVVHFYDQGESLVLKEGMFFTIEPMINAGKHETLLSRLDNWTVTTRDLSLSAQFEHTLGVTEDGVEIFTLSPKNWHFPPYN

Atome Classification :

(91 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

U17_A_5(2GGB)
MAP1_ECOLI
[Raw transfer]




Q08_A_5(4U1B)
MAP11_HUMAN
[Raw transfer]




NLP_A_9(2GU6)
MAP1_ECOLI
[Raw transfer]




YE7_A_4(2P98)
MAP1_ECOLI
[Raw transfer]




NLP_A_5(1C27)
MAP1_ECOLI
[Raw transfer]




Y16_A_4(4FLI)
MAP11_HUMAN
[Raw transfer]




Y10_A_4(4FLK)
MAP11_HUMAN
[Raw transfer]




Q06_A_6(4U6C)
MAP11_HUMAN
[Raw transfer]




Q07_A_6(4U6Z)
MAP11_HUMAN
[Raw transfer]




NLP_B_10(2GU5)
MAP1_ECOLI
[Raw transfer]




NLP_B_8(2GTX)
MAP1_ECOLI
[Raw transfer]




5C1_A_3(4A6W)
?
[Raw transfer]




NLP_B_10(2GU6)
MAP1_ECOLI
[Raw transfer]




Q08_A_6(4U6W)
MAP11_HUMAN
[Raw transfer]




U15_A_5(2GG8)
MAP1_ECOLI
[Raw transfer]




MPH_A_5(1C23)
MAP1_ECOLI
[Raw transfer]




Y08_A_4(4FLJ)
MAP11_HUMAN
[Raw transfer]




Q04_A_5(4U70)
MAP11_HUMAN
[Raw transfer]




NLP_A_9(2GU5)
MAP1_ECOLI
[Raw transfer]




NLP_A_9(2GU4)
MAP1_ECOLI
[Raw transfer]




NLP_B_10(2GU4)
MAP1_ECOLI
[Raw transfer]




U16_A_5(2GG9)
MAP1_ECOLI
[Raw transfer]




Q07_A_5(4U69)
MAP11_HUMAN
[Raw transfer]




NLP_A_7(2GTX)
MAP1_ECOLI
[Raw transfer]




Q02_A_5(4U73)
MAP11_HUMAN
[Raw transfer]




Q03_A_6(4U71)
MAP11_HUMAN
[Raw transfer]




MPJ_A_5(1C24)
MAP1_ECOLI
[Raw transfer]




Y02_A_4(3PKA)
MAP12_MYCTU
[Raw transfer]




Y10_A_2(3PKE)
MAP12_MYCTU
[Raw transfer]




Q02_A_4(4U6E)
MAP11_HUMAN
[Raw transfer]




W29_A_4(3D27)
MAP1_ECOLI
[Raw transfer]




YZ6_A_4(4FLL)
MAP11_HUMAN
[Raw transfer]




IKY_A_5(4A6V)
?
[Raw transfer]




U11_A_5(2GG0)
MAP1_ECOLI
[Raw transfer]




MET_D_21(4FO8)
?
[Raw transfer]




GOL_A_9(2B3H)
MAP11_HUMAN
[Raw transfer]




MET_A_9(4FO8)
?
[Raw transfer]




GOL_A_9(2B3H)
MAP11_HUMAN
[Raw transfer]




MET_A_5(2GGC)
MAP1_ECOLI
[Raw transfer]




U14_A_5(2GG7)
MAP1_ECOLI
[Raw transfer]




MET_C_17(4FO8)
?
[Raw transfer]




CHAIN_I_2(3MAT)
MAP1_ECOLI
[Raw transfer]

-

MET_A_6(4U6J)
MAP11_HUMAN
[Raw transfer]




B21_A_5(2Q93)
MAP1_ECOLI
[Raw transfer]




MET_B_13(4FO8)
?
[Raw transfer]




GOL_A_4(2B3L)
MAP11_HUMAN
[Raw transfer]




MET_B_4(3MX6)
MAP1_RICPR
[Raw transfer]




MET_A_6(4U75)
MAP11_HUMAN
[Raw transfer]




GOL_A_6(4U76)
MAP11_HUMAN
[Raw transfer]




U12_A_5(2GG2)
MAP1_ECOLI
[Raw transfer]




IKY_B_7(4A6V)
?
[Raw transfer]




U12_A_5(2GG2)
MAP1_ECOLI
[Raw transfer]




MET_A_5(1C21)
MAP1_ECOLI
[Raw transfer]




YE6_A_4(2P99)
MAP1_ECOLI
[Raw transfer]




U13_A_5(2GG3)
MAP1_ECOLI
[Raw transfer]




A18_A_5(2Q96)
MAP1_ECOLI
[Raw transfer]




FCD_A_5(1XNZ)
MAP1_ECOLI
[Raw transfer]




FCD_A_4(3IU7)
MAP12_MYCTU
[Raw transfer]




FC2_A_5(2EVM)
MAP1_ECOLI
[Raw transfer]




MET_A_3(3MX6)
MAP1_RICPR
[Raw transfer]




MET_A_3(3MX6)
MAP1_RICPR
[Raw transfer]




B23_A_5(2Q92)
MAP1_ECOLI
[Raw transfer]




U19_A_5(2GG5)
MAP1_ECOLI
[Raw transfer]




A05_A_5(2Q95)
MAP1_ECOLI
[Raw transfer]




FC3_A_5(2EVC)
MAP1_ECOLI
[Raw transfer]




MF3_A_5(1C22)
MAP1_ECOLI
[Raw transfer]




A04_A_5(2Q94)
MAP1_ECOLI
[Raw transfer]




T03_A_5(3IU8)
MAP12_MYCTU
[Raw transfer]




TFV_A_2(4IKT)
MAP11_HUMAN
[Raw transfer]




T07_A_4(3IU9)
MAP12_MYCTU
[Raw transfer]




QMS_A_6(2BB7)
MAP1_ECOLI
[Raw transfer]




7NP_A_2(4PNC)
?
[Raw transfer]




HM2_A_6(2G6P)
MAP11_HUMAN
[Raw transfer]




TMG_A_7(1YVM)
MAP1_ECOLI
[Raw transfer]




1AY_A_6(4HXX)
MAP11_HUMAN
[Raw transfer]




FZ1_A_6(4IU6)
MAP11_HUMAN
[Raw transfer]




HM5_A_6(2NQ7)
MAP11_HUMAN
[Raw transfer]




PVP_A_5(4IKR)
MAP11_HUMAN
[Raw transfer]




HM4_A_6(2NQ6)
MAP11_HUMAN
[Raw transfer]




SHX_A_2(4IKU)
MAP11_HUMAN
[Raw transfer]




TFD_A_2(4IKS)
MAP11_HUMAN
[Raw transfer]




CT0_A_10(2EVO)
MAP1_ECOLI
[Raw transfer]




CT0_B_9(2EVO)
MAP1_ECOLI
[Raw transfer]




CIT_A_4(3TB5)
?
[Raw transfer]




LMR_A_8(3TAV)
?
[Raw transfer]




YE6_A_5(2P9A)
MAP1_ECOLI
[Raw transfer]




21 PsiBlast_CBE 96.2966%-105 - C1 -3MX6 3.2 MAP1_RICPR
101 HHSearch 95.8566%-108 - C1 -3MX6 2.5 MAP1_RICPR
1 PsiBlast_PDB 95.8566%-108 - C1 -3MX6 2.5 MAP1_RICPR
22 PsiBlast_CBE 90.4366%-108 - C1 -3MR1 - MAP1_RICPR -
24 PsiBlast_CBE 89.7066%-108 - C1 -3MR1 - MAP1_RICPR -
23 PsiBlast_CBE 89.2666%-106 - C1 -3MR1 - MAP1_RICPR -
49 PsiBlast_CBE 88.5356%-109 - C1 -1C22 3.3 MAP1_ECOLI
2 PsiBlast_PDB 88.5266%-104 - C1 -3MR1 - MAP1_RICPR -
52 PsiBlast_CBE 86.8956%-108 - C1 -2Q92 3.5 MAP1_ECOLI
14 PsiBlast_PDB 86.7056%-109 - C1 -2MAT - MAP1_ECOLI -
40 PsiBlast_CBE 86.5856%-111 - C1 -2GGB 3.8 MAP1_ECOLI
47 PsiBlast_CBE 86.4956%-109 - C1 -1C24 3.4 MAP1_ECOLI
48 PsiBlast_CBE 86.3356%-110 - C1 -1C23 3.7 MAP1_ECOLI
8 PsiBlast_PDB 86.2356%-109 - C1 -2BB7 4.1 MAP1_ECOLI
46 PsiBlast_CBE 86.0656%-109 - C1 -1C27 3.6 MAP1_ECOLI
50 PsiBlast_CBE 85.9656%-106 - C1 -1C21 3.3 MAP1_ECOLI
16 PsiBlast_PDB 85.8856%-109 - C1 -4A6W 4.6 ?
42 PsiBlast_CBE 85.8356%-109 - C1 -2GG8 4.9 MAP1_ECOLI
15 PsiBlast_PDB 85.6956%-110 - C1 -1YVM 4.1 MAP1_ECOLI
36 PsiBlast_CBE 85.6656%-109 - C1 -2Q96 4.7 MAP1_ECOLI
53 PsiBlast_CBE 85.5656%-109 - C1 -2P9A 4.3 MAP1_ECOLI
39 PsiBlast_CBE 85.4956%-109 - C1 -2GGC 3.5 MAP1_ECOLI
41 PsiBlast_CBE 85.4256%-108 - C1 -2GG9 6.0 MAP1_ECOLI
6 PsiBlast_PDB 85.3356%-107 - C1 -4A6V 5.2 ?
19 PsiBlast_PDB 84.7256%-108 - C1 -2GG0 5.2 MAP1_ECOLI
43 PsiBlast_CBE 84.6756%-109 - C1 -2GG7 4.4 MAP1_ECOLI
55 PsiBlast_CBE 84.5556%-109 - C1 -2P99 5.1 MAP1_ECOLI
45 PsiBlast_CBE 84.1956%-108 - C1 -2GG3 4.3 MAP1_ECOLI
44 PsiBlast_CBE 84.1556%-108 - C1 -2GG5 4.4 MAP1_ECOLI
51 PsiBlast_CBE 84.1156%-109 - C1 -2Q94 4.9 MAP1_ECOLI
25 PsiBlast_CBE 83.9556%-107 - C1 -4FO8 2.6 ?
60 PsiBlast_CBE 83.7156%-106 - C1 -2GU5 3.9 MAP1_ECOLI
7 PsiBlast_PDB 83.6656%-107 - C1 -1XNZ 4.5 MAP1_ECOLI
20 PsiBlast_PDB 83.6056%-107 - C1 -2GG2 4.8 MAP1_ECOLI
65 PsiBlast_CBE 83.5456%-107 - C1 -2GTX 3.8 MAP1_ECOLI
35 PsiBlast_CBE 83.5256%-102 - C1 -2EVO 3.4 MAP1_ECOLI
66 PsiBlast_CBE 83.4456%-105 - C1 -2GTX 3.9 MAP1_ECOLI
54 PsiBlast_CBE 83.3456%-108 - C1 -2P98 5.2 MAP1_ECOLI
59 PsiBlast_CBE 83.2956%-104 - C1 -2GU6 4.1 MAP1_ECOLI
11 PsiBlast_PDB 83.1456%-107 - C1 -2EVO 3.4 MAP1_ECOLI
58 PsiBlast_CBE 83.0356%-107 - C1 -2GU6 4.0 MAP1_ECOLI
62 PsiBlast_CBE 82.7256%-108 - C1 -2GU4 3.0 MAP1_ECOLI
61 PsiBlast_CBE 82.2756%-104 - C1 -2GU5 3.9 MAP1_ECOLI
10 PsiBlast_PDB 82.1656%-105 - C1 -2EVM 4.9 MAP1_ECOLI
17 PsiBlast_PDB 82.1256%-108 - C1 -4PNC 4.1 ?
4 PsiBlast_PDB 82.0756%-104 - C1 -4FO8 2.6 ?
37 PsiBlast_CBE 81.9456%-108 - C1 -2Q95 4.7 MAP1_ECOLI
38 PsiBlast_CBE 81.9256%-107 - C1 -2Q93 4.0 MAP1_ECOLI
63 PsiBlast_CBE 81.7656%-105 - C1 -2GU4 3.1 MAP1_ECOLI
9 PsiBlast_PDB 81.5956%-104 - C1 -2EVC 5.4 MAP1_ECOLI
64 PsiBlast_CBE 81.4656%-105 - C1 -3D27 4.5 MAP1_ECOLI
34 PsiBlast_CBE 81.1756%-107 - C1 -4A6V 4.6 ?
13 PsiBlast_PDB 81.0656%-107 - C1 -3MAT 4.7 MAP1_ECOLI
76 PsiBlast_CBE 80.2647%-103 - C1 -4HXX 4.9 MAP11_HUMAN
67 PsiBlast_CBE 80.1447%-103 - C1 -4IU6 4.9 MAP11_HUMAN
26 PsiBlast_CBE 80.1256%-105 - C1 -4FO8 2.6 ?
102 HHSearch 80.0754%-100 - C1 -2GG2 4.8 MAP1_ECOLI
84 PsiBlast_CBE 79.6947%-103 - C1 -4U6J 2.8 MAP11_HUMAN
75 PsiBlast_CBE 79.4447%-104 - C1 -4IKR 5.5 MAP11_HUMAN
90 PsiBlast_CBE 79.2347%-101 - C1 -4U75 2.8 MAP11_HUMAN
69 PsiBlast_CBE 79.1547%-102 - C1 -4FLK 7.2 MAP11_HUMAN
78 PsiBlast_CBE 78.8347%-102 - C1 -2NQ6 4.6 MAP11_HUMAN
73 PsiBlast_CBE 78.7947%-103 - C1 -4IKT 6.6 MAP11_HUMAN
68 PsiBlast_CBE 78.6347%-102 - C1 -4FLL 8.1 MAP11_HUMAN
77 PsiBlast_CBE 78.6147%-101 - C1 -2NQ7 4.7 MAP11_HUMAN
70 PsiBlast_CBE 78.3347%-101 - C1 -4FLJ 6.2 MAP11_HUMAN
88 PsiBlast_CBE 78.3247%-102 - C1 -4U1B 3.5 MAP11_HUMAN
92 PsiBlast_CBE 77.9947%-100 - C1 -4U71 3.8 MAP11_HUMAN
71 PsiBlast_CBE 77.9247%-104 - C1 -4FLI 5.4 MAP11_HUMAN
87 PsiBlast_CBE 77.8947%-102 - C1 -4U69 3.1 MAP11_HUMAN
81 PsiBlast_CBE 77.8047%-102 - C1 -2B3L 2.1 MAP11_HUMAN
72 PsiBlast_CBE 77.7747%-101 - C1 -4IKU 6.0 MAP11_HUMAN
27 PsiBlast_CBE 77.7656%-102 - C1 -4FO8 2.7 ?
93 PsiBlast_CBE 77.7147%-100 - C1 -4U70 3.6 MAP11_HUMAN
74 PsiBlast_CBE 77.6047%-102 - C1 -4IKS 5.2 MAP11_HUMAN
95 PsiBlast_CBE 77.3647% -99 - C1 -4U6W 3.8 MAP11_HUMAN
83 PsiBlast_CBE 77.3547%-101 - C1 -2B3H 2.6 MAP11_HUMAN
89 PsiBlast_CBE 77.1347%-101 - C1 -4U76 2.2 MAP11_HUMAN
94 PsiBlast_CBE 77.1147%-100 - C1 -4U6Z 4.1 MAP11_HUMAN
80 PsiBlast_CBE 77.1147%-100 - C1 -2G6P 5.9 MAP11_HUMAN
91 PsiBlast_CBE 76.9947%-102 - C1 -4U73 3.5 MAP11_HUMAN
99 PsiBlast_CBE 76.6347% -99 - C1 -3IU7 4.4 MAP12_MYCTU
85 PsiBlast_CBE 76.3647%-103 - C1 -4U6E 3.6 MAP11_HUMAN
100 PsiBlast_CBE 76.1947% -99 - C1 -3PKE 6.9 MAP12_MYCTU
86 PsiBlast_CBE 76.1247%-100 - C1 -4U6C 3.4 MAP11_HUMAN
97 PsiBlast_CBE 75.6747%-101 - C1 -3IU9 6.3 MAP12_MYCTU
98 PsiBlast_CBE 73.6247% -98 - C1 -3IU8 4.5 MAP12_MYCTU
106 HHSearch 73.5846% -96 - C1 -3PKA 7.3 MAP12_MYCTU
104 HHSearch 73.3446% -95 - C1 -2B3H 2.6 MAP11_HUMAN
103 HHSearch 72.1736% -99 - C1 -3TB5 3.3 ?
110 HHSearch 61.5237% -92 - C1 -3TAV 2.3 ?