@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0228: (2015-11-29 )
MFDVTILTIFPEMFPGFLNYSLAGKALEKKIWNLQVINIRFFAKDRHLTVDHIPYGGGAGMIMRPDVVGDAVDSVLSTHKDTKFIYMTPSGTKFDQSIARELVGFPHITILCGRFEGIDQRVIDEYTPYELSIGDYILSGGEPAAMVILDVCVRLLPGVVNNSGSITEESFSYSGGVLEYPQYTRPKQWRKHRVPKILLSGNHKKISDWRQKQSQVITKRRRPELLDGEINDKFT

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_A_2(1P9P)
TRMD_ECOLI
[Raw transfer]




21X_A_3(4MCC)
TRMD_HAEIN
[Raw transfer]




21W_B_8(4MCB)
TRMD_HAEIN
[Raw transfer]




21X_B_4(4MCC)
TRMD_HAEIN
[Raw transfer]




SFG_A_2(4YVH)
?
[Raw transfer]




SAH_A_2(4IG6)
TRMD_ANAPZ
[Raw transfer]




SAH_A_3(4H3Y)
TRMD_BURP8
[Raw transfer]




21W_A_5(4MCB)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_A_3(4H3Z)
TRMD_BURP8
[Raw transfer]




SAH_E_5(1UAM)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVK)
?
[Raw transfer]




SFG_B_5(4YVK)
?
[Raw transfer]




SFG_B_5(4YVJ)
?
[Raw transfer]




SFG_B_5(4YVI)
?
[Raw transfer]




SAM_A_2(4YVG)
?
[Raw transfer]




SAM_C_3(1UAK)
TRMD_HAEIN
[Raw transfer]




SAH_B_6(4H3Z)
TRMD_BURP8
[Raw transfer]




ADN_A_2(3AXZ)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVI)
?
[Raw transfer]




SFG_A_4(4YVJ)
?
[Raw transfer]




22L_A_2(4MCD)
TRMD_HAEIN
[Raw transfer]




EDO_B_6(3QUV)
?
[Raw transfer]




EDO_A_3(3QUV)
?
[Raw transfer]




EDO_A_4(3QUV)
?
[Raw transfer]




EDO_A_4(3QUV)
?
[Raw transfer]




2 PsiBlast_PDB 93.6655%-147 - C4 -4IG6 7.4 TRMD_ANAPZ
1 PsiBlast_PDB 92.9055%-167 - C4 -3KNU - TRMD_ANAPZ -
3 PsiBlast_PDB 92.8350%-157 - C4 -3IEF - TRMD_BARHE -
29 HHSearch 92.5150%-149 - C4 -3IEF - TRMD_BARHE -
21 PsiBlast_CBE 91.5044%-157 - C4 -3QUV 2.2 ?
52 Fugue 91.0939%-151 * C4 *1UAL 6.8 TRMD_HAEIN
32 HHSearch 91.0544%-163 - C4 -3QUV 1.1 ?
4 PsiBlast_PDB 90.1644%-162 - C4 -3QUV 2.3 ?
23 PsiBlast_CBE 90.1240%-151 - C4 -4MCB 6.8 TRMD_HAEIN
15 PsiBlast_PDB 90.0040%-164 - C4 -1UAJ - TRMD_HAEIN -
24 PsiBlast_CBE 89.7840%-151 - C4 -4YVK 6.1 ?
25 PsiBlast_CBE 89.5740%-150 - C4 -4YVJ 5.7 ?
10 PsiBlast_PDB 89.5540%-157 - C4 -4YVG 7.8 ?
5 PsiBlast_PDB 89.3943%-159 - C4 -1P9P 6.6 TRMD_ECOLI
17 PsiBlast_PDB 89.2740%-160 - C4 -1UAL 6.8 TRMD_HAEIN
11 PsiBlast_PDB 88.8640%-156 - C4 -4YVH 7.3 ?
26 PsiBlast_CBE 88.8140%-152 - C4 -4YVI 7.2 ?
22 PsiBlast_CBE 88.5340%-162 - C4 -4MCC 6.3 TRMD_HAEIN
18 PsiBlast_PDB 88.4740%-148 - C4 -1UAM 6.8 TRMD_HAEIN
16 PsiBlast_PDB 88.4040%-160 - C4 -1UAK 7.7 TRMD_HAEIN
20 PsiBlast_PDB 88.3536%-152 - C4 -4H3Z 7.3 TRMD_BURP8
13 PsiBlast_PDB 88.3440%-157 - C4 -4YVJ 7.3 ?
14 PsiBlast_PDB 88.2340%-158 - C4 -4YVK 7.4 ?
9 PsiBlast_PDB 88.2340%-160 - C4 -3AXZ 6.1 TRMD_HAEIN
12 PsiBlast_PDB 87.7940%-157 - C4 -4YVI 7.6 ?
8 PsiBlast_PDB 87.6040%-158 - C4 -4MCD 5.6 TRMD_HAEIN
6 PsiBlast_PDB 87.0340%-159 - C4 -4MCB 6.7 TRMD_HAEIN
7 PsiBlast_PDB 86.7140%-161 - C4 -4MCC 6.4 TRMD_HAEIN
19 PsiBlast_PDB 84.0636%-150 - C4 -4H3Y 7.0 TRMD_BURP8
27 PsiBlast_CBE 81.8536%-147 - C4 -4H3Z 6.8 TRMD_BURP8