@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0240: (2015-11-29 )
MSNKYYDSNNIFAQILRGELPCKKVYEDEDVLAFYDKYPDAPVHILVVPKSQYISYDDFIFKASAEEIVGFFKTVREITYKYNLEKTGYRLVTNCGENGEQVVPHFHMHILGGKRLGKHVNL

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_A_3(3OMF)
HIT_ENTHI
[Raw transfer]




AMP_C_12(4ZGL)
YHIT_HELPY
[Raw transfer]




AMP_C_3(1KPF)
HINT1_HUMAN
[Raw transfer]




AMP_H_14(4ZGL)
YHIT_HELPY
[Raw transfer]




5GP_B_6(4EGU)
?
[Raw transfer]




AMP_A_3(3TW2)
HINT1_HUMAN
[Raw transfer]




AMP_B_11(4ZGL)
YHIT_HELPY
[Raw transfer]




AMP_I_15(4ZGL)
YHIT_HELPY
[Raw transfer]




8BR_A_2(5RHN)
HINT1_RABIT
[Raw transfer]




5GP_A_3(3OXK)
HIT_ENTHI
[Raw transfer]




5AS_C_3(1RZY)
HINT1_RABIT
[Raw transfer]




AMP_F_13(4ZGL)
YHIT_HELPY
[Raw transfer]




ADN_A_2(3O1X)
HINT1_RABIT
[Raw transfer]




ADN_A_2(3O1C)
HINT1_RABIT
[Raw transfer]




ADN_A_2(3O1C)
HINT1_RABIT
[Raw transfer]




RIB_C_3(4RHN)
HINT1_RABIT
[Raw transfer]




IPA_B_6(4NJZ)
HINT2_HUMAN
[Raw transfer]




EDO_A_11(3N1S)
HINT_ECOLI
[Raw transfer]




21 PsiBlast_CBE 90.3247%-148 - C6 -4EGU 6.4 ?
47 PsiBlast_CBE 88.9640%-137 - C6 -3N1S - HINT_ECOLI -
18 PsiBlast_PDB 88.7339%-157 - C6 -1KPC - HINT1_HUMAN -
43 PsiBlast_CBE 88.6540%-137 - C6 -3N1S - HINT_ECOLI -
50 PsiBlast_CBE 88.4940%-136 - C6 -3N1S - HINT_ECOLI -
48 PsiBlast_CBE 88.3940%-137 - C6 -3N1S - HINT_ECOLI -
16 PsiBlast_PDB 88.3039%-149 - C6 -1KPB - HINT1_HUMAN -
51 PsiBlast_CBE 88.2139%-138 - C6 -3N1T - HINT_ECOLI -
49 PsiBlast_CBE 88.0340%-136 - C6 -3N1S 2.7 HINT_ECOLI
54 PsiBlast_CBE 87.7239%-136 - C6 -3N1T - HINT_ECOLI -
1 PsiBlast_PDB 87.4937%-132 - C6 -1XQU - ? -
17 PsiBlast_PDB 87.4439%-153 - C6 -1KPA - HINT1_HUMAN -
44 PsiBlast_CBE 87.2940%-132 - C6 -3N1S - HINT_ECOLI -
19 PsiBlast_PDB 87.1539%-146 - C6 -1KPE - HINT1_HUMAN -
15 PsiBlast_PDB 87.0339%-153 - C6 -3TW2 5.9 HINT1_HUMAN
46 PsiBlast_CBE 86.9940%-140 - C6 -3N1S - HINT_ECOLI -
29 PsiBlast_CBE 86.7839%-148 - C6 -4EQG - HINT1_HUMAN -
32 PsiBlast_CBE 86.6339%-149 - C6 -1AV5 - HINT1_HUMAN -
28 PsiBlast_CBE 86.6339%-148 - C6 -4EQH - HINT1_HUMAN -
31 PsiBlast_CBE 86.6239%-150 - C6 -1KPE - HINT1_HUMAN -
20 PsiBlast_PDB 86.5939%-154 - C6 -1KPF 6.2 HINT1_HUMAN
33 PsiBlast_CBE 84.8840%-148 - C6 -3OXK 5.9 HIT_ENTHI
34 PsiBlast_CBE 84.6540%-147 - C6 -3OMF 5.3 HIT_ENTHI
4 PsiBlast_PDB 83.5038%-140 - C6 -3O1C 4.4 HINT1_RABIT
24 PsiBlast_CBE 83.4137%-152 - C6 -4ZGL 5.0 YHIT_HELPY
26 PsiBlast_CBE 83.3137%-159 - C6 -4ZGL 5.0 YHIT_HELPY
23 PsiBlast_CBE 82.9237%-155 - C6 -4ZGL 4.8 YHIT_HELPY
40 PsiBlast_CBE 82.7940%-135 - C6 -4NJZ 3.6 HINT2_HUMAN
6 PsiBlast_PDB 82.5238%-145 - C6 -1RZY 5.8 HINT1_RABIT
27 PsiBlast_CBE 81.9337%-153 - C6 -4ZGL 4.9 YHIT_HELPY
25 PsiBlast_CBE 80.9037%-148 - C6 -4ZGL 4.9 YHIT_HELPY
10 PsiBlast_PDB 78.0338%-127 - C6 -5RHN 6.4 HINT1_RABIT
5 PsiBlast_PDB 77.8538%-124 - C6 -3O1X 4.6 HINT1_RABIT
9 PsiBlast_PDB 77.6838%-121 - C6 -4RHN 2.8 HINT1_RABIT
77 HHSearch 74.5532%-111 - C6 -3O1C 4.4 HINT1_RABIT