@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0242: (2015-11-29 )
MIGQVLSNDDWNRYKKEGFLVTKFGSLIDYVINWARSGSLWPMTFGLACCAVEMMHTASSRYDLDRYGIMFRASPRQADVMIVAGTLTNKMAAALRKVYDQMADPKYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGMLCLQNKIKRTQNI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SF4_R_(2FUG)
NQO6_THET8
[Raw transfer]
24 PsiBlast_CBE 95.6752%-164 - C4 -2FUG 4.0 NQO6_THET8
28 HHSearch 71.4517%-110 - C4 -2WPN - ? -
26 HHSearch 69.6920%-106 - C4 -3AYX - ? -
27 HHSearch 66.8119%-104 - C4 -3MYR - ? -
2 PsiBlast_PDB 65.3427%-116 - C4 -4OMF - ? -
29 HHSearch 62.9317%-114 * C4 *1YQ9 - PHNS_DESGI -
1 PsiBlast_PDB 62.5227%-119 - C4 -4CI0 - ? -
49 Fugue 62.2317% -95 - C4 -1FRF - PHNS_DESFR -
3 PsiBlast_PDB 61.3329%-102 - C4 -5CH9 - ? -
31 HHSearch 60.3517%-121 - C4 -1H2A - PHNS_DESVM -
56 Fugue 59.3513% -90 - C4 -1H2A - PHNS_DESVM -
16 PsiBlast_PDB 58.8222% -79 - C4 -1D8C - MASZ_ECOLI -
10 PsiBlast_PDB 55.2322% -82 - C4 -1Y8B - MASZ_ECOLI -
53 Fugue 54.9916% -88 - C3 -2KJQ - ? -
55 Fugue 54.7912% -82 - C3 -4DDP - BECN1_HUMAN -
57 Fugue 53.9516% -55 * C3 *1HIW - POL_HV1N5 -
11 PsiBlast_PDB 53.2822% -56 - C4 -2JQX - MASZ_ECOLI -
50 Fugue 52.7818% -65 - C3 -4K0D - ? -
51 Fugue 51.4512% -79 - C2 -4TSD - ? -
12 PsiBlast_PDB 48.5029%-114 - C4 -3AYX - ? -