@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0292: (2015-11-30 )
MAVMPDKWIREKAESFGMIEPFVDHKSSKGVMSFGLSSYGYDARVDNKFKIFTNVNSAVVDPKDFSKNSFIDKETDVCIIPPNSFALASTVEYFHIPRDVLAICVGKSTYARCGIIVNVTPLEPGWKGHVTLEFSNTTPLPAKIYANEGACQFVFLSGESECEKSYDDIKGKYMNQHGITLPLVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_9(4DHK)
DCD_BURTA
[Raw transfer]




21 PsiBlast_CBE 93.0971%-146 - C6 -3KM3 - DCD_ANAPZ -
51 HHSearch 92.8371%-148 - C6 -3KM3 - DCD_ANAPZ -
1 PsiBlast_PDB 91.0471%-138 - C6 -3KM3 - DCD_ANAPZ -
2 PsiBlast_PDB 89.3562%-132 - C6 -4DHK - DCD_BURTA -
22 PsiBlast_CBE 87.0462%-139 - C6 -4DHK 3.1 DCD_BURTA
53 HHSearch 67.2229% -96 - C6 -2QXX - DCD_MYCTU -
52 HHSearch 61.2126% -95 - C6 -1XS1 - DCD_ECOLI -
72 Fugue 59.6125% -95 - C6 -1XS1 - DCD_ECOLI -
3 PsiBlast_PDB 59.2030% -95 - C6 -2QXX - DCD_MYCTU -
19 PsiBlast_PDB 58.8025%-102 - C6 -2YZJ - ? -
35 PsiBlast_CBE 57.9132% -91 - C6 -2V9X - DCD_ECOLI -
44 PsiBlast_CBE 57.8932% -88 - C6 -1XS6 - DCD_ECOLI -
43 PsiBlast_CBE 57.8532% -90 - C6 -1XS6 - DCD_ECOLI -
33 PsiBlast_CBE 57.8032% -90 - C6 -2V9X - DCD_ECOLI -
25 PsiBlast_CBE 57.7732% -89 - C6 -1XS1 - DCD_ECOLI -
7 PsiBlast_PDB 57.6632% -89 - C6 -2V9X - DCD_ECOLI -
32 PsiBlast_CBE 57.6532% -90 - C6 -2V9X - DCD_ECOLI -
54 HHSearch 57.5522%-104 - C6 -2YZJ - ? -
34 PsiBlast_CBE 57.3132% -88 - C6 -2V9X - DCD_ECOLI -
26 PsiBlast_CBE 57.3132% -88 - C6 -1XS1 - DCD_ECOLI -