Study : Wbm0397 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C5_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C5_S1
Complex: ACY_M_13(2FW1) / Model_21(2FW1/B) = [3.3] Download510.9111.93MLNMAEIKKDVAVIMGSESDYSTMIHAVDMLTELGILHDVFIISAHRTPERLFNFAQSAQEKGFRVIIAGAGGAAHLPGMVASLTCLPVIGVPVHSKQLNGLDSLLSIVQMPKGVPVATMSIGESGAYNAAIAAASVLSISNSEIADRLKKWRKEQTEVVKEKPASQ
Complex: FMT_A_7(3LP6) / Model_59(3LP6/A) = [3.4] Download230.195.80MLNMAEIKKDVAVIMGSESDYSTMIHAVDMLTELGILHDVFIISAHRTPERLFNFAQSAQEKGFRVIIAGAGGAAHLPGMVASLTCLPVIGVPVHSKQLNGLDSLLSIVQMPKGVPVATMSIGESGAYNAAIAAASVLSISNSEIADRLKKWRKEQTEVVKEKPASQ
Complex: FMT_A_7(3LP6) / Model_34(3LP6/A) = [3.4] Download204.855.80MLNMAEIKKDVAVIMGSESDYSTMIHAVDMLTELGILHDVFIISAHRTPERLFNFAQSAQEKGFRVIIAGAGGAAHLPGMVASLTCLPVIGVPVHSKQLNGLDSLLSIVQMPKGVPVATMSIGESGAYNAAIAAASVLSISNSEIADRLKKWRKEQTEVVKEKPASQ
Complex: ACY_I_9(2FW1) / Model_1(2FW1/A) = [3.6] Download595.86-0.86MLNMAEIKKDVAVIMGSESDYSTMIHAVDMLTELGILHDVFIISAHRTPERLFNFAQSAQEKGFRVIIAGAGGAAHLPGMVASLTCLPVIGVPVHSKQLNGLDSLLSIVQMPKGVPVATMSIGESGAYNAAIAAASVLSISNSEIADRLKKWRKEQTEVVKEKPASQ
Complex: CIT_B_3(2FW6) / Model_24(2FW6/B) = [3.6] Download306.756.93MLNMAEIKKDVAVIMGSESDYSTMIHAVDMLTELGILHDVFIISAHRTPERLFNFAQSAQEKGFRVIIAGAGGAAHLPGMVASLTCLPVIGVPVHSKQLNGLDSLLSIVQMPKGVPVATMSIGESGAYNAAIAAASVLSISNSEIADRLKKWRKEQTEVVKEKPASQ
Consensus
[pKd Mean = 3.46]
-369
(s=156)
5
(s=4)
MLNMAEIKKDVAVIMGSESDYSTMIHAVDMLTELGILHDVFIISAHRTPERLFNFAQSAQEKGFRVIIAGAGGAAHLPGMVASLTCLPVIGVPVHSKQLNGLDSLLSIVQMPKGVPVATMSIGESGAYNAAIAAASVLSISNSEIADRLKKWRKEQTEVVKEKPASQ