@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0397: (2015-12-01 )
MLNMAEIKKDVAVIMGSESDYSTMIHAVDMLTELGILHDVFIISAHRTPERLFNFAQSAQEKGFRVIIAGAGGAAHLPGMVASLTCLPVIGVPVHSKQLNGLDSLLSIVQMPKGVPVATMSIGESGAYNAAIAAASVLSISNSEIADRLKKWRKEQTEVVKEKPASQ

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

C2R_I_9(2NSL)
PURE_ECOLI
[Raw transfer]




NIA_A_2(2NSH)
PURE_ECOLI
[Raw transfer]




C2R_I_9(2NSJ)
PURE_ECOLI
[Raw transfer]




AIR_I_9(2FWJ)
?
[Raw transfer]




AIR_A_3(2FWI)
?
[Raw transfer]




CIT_B_3(2FW6)
?
[Raw transfer]




CIT_M_13(2FWP)
?
[Raw transfer]




CIT_A_3(1U11)
?
[Raw transfer]




CIT_A_3(1U11)
?
[Raw transfer]




GOL_B_9(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_B_14(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_A_7(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_C_21(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_A_7(3LP6)
PURE_MYCTU
[Raw transfer]




CIT_B_4(1U11)
?
[Raw transfer]




FMT_D_26(3LP6)
PURE_MYCTU
[Raw transfer]




ACY_I_9(2FW1)
?
[Raw transfer]




ACY_M_13(2FW1)
?
[Raw transfer]




22 PsiBlast_CBE 97.4259%-160 - C5 -1U11 3.7 ?
3 PsiBlast_PDB 97.1159%-160 - C5 -1U11 3.8 ?
6 PsiBlast_PDB 97.0959%-160 - C5 -2FWA - ? -
17 PsiBlast_PDB 96.8859%-158 - C5 -2FW8 - ? -
14 PsiBlast_PDB 96.8659%-160 - C5 -2FW9 - ? -
15 PsiBlast_PDB 96.8259%-160 - C5 -2FWB - ? -
2 PsiBlast_PDB 96.7759%-160 - C5 -2FWJ 4.7 ?
23 PsiBlast_CBE 96.7459%-156 - C5 -2FWP 4.0 ?
21 PsiBlast_CBE 96.7359%-161 - C5 -2FW1 3.3 ?
4 PsiBlast_PDB 96.6259%-159 - C5 -2FW6 - ? -
5 PsiBlast_PDB 96.3559%-157 - C5 -2FW7 - ? -
31 PsiBlast_CBE 96.2353%-158 - C5 -3LP6 3.0 PURE_MYCTU
1 PsiBlast_PDB 95.8459%-159 - C5 -2FW1 3.6 ?
53 HHSearch 95.8358%-151 - C5 -1U11 3.8 ?
24 PsiBlast_CBE 95.8359%-155 - C5 -2FW6 3.6 ?
29 PsiBlast_CBE 95.6756%-147 - C5 -4AY3 - ? -
13 PsiBlast_PDB 95.6259%-161 - C5 -2FWI 3.8 ?
18 PsiBlast_PDB 95.6155%-155 - C5 -2NSL 6.0 PURE_ECOLI
30 PsiBlast_CBE 95.6056%-152 - C5 -4AY3 - ? -
25 PsiBlast_CBE 95.4556%-147 - C5 -4AY4 - ? -
32 PsiBlast_CBE 94.5453%-158 - C5 -3LP6 3.6 PURE_MYCTU
33 PsiBlast_CBE 94.3953%-155 - C5 -3LP6 3.6 PURE_MYCTU
20 PsiBlast_PDB 94.0355%-151 - C5 -2NSJ 5.9 PURE_ECOLI
19 PsiBlast_PDB 93.9255%-152 - C5 -2NSH 5.7 PURE_ECOLI
34 PsiBlast_CBE 93.4653%-155 - C5 -3LP6 3.4 PURE_MYCTU
59 HHSearch 93.0453%-152 - C5 -3LP6 3.4 PURE_MYCTU