@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0420: (2015-12-01 )
MMKKVKLGILISGRGSNMQALMKACQNYGFPAEMACVISNNNKAAGLKVAEQAGMPTFVVENKPLDVDKIHEILVQHEVNLVCLAGFMRILKADFLNKWHGKVINVHPSLLPSFKGLNAQEQALKAGVKVTGCTVHYVTSEVDAGAIIAQAAVPVLPNDDIHSLSKRILSEEHKCYVEAVRLIAMLSRKLERP

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KEU_K_11(1RBQ)
PUR2_HUMAN
[Raw transfer]




KT5_C_3(1RBZ)
PUR2_HUMAN
[Raw transfer]




KEU_L_12(1RBQ)
PUR2_HUMAN
[Raw transfer]




KT5_G_7(1RBM)
PUR2_HUMAN
[Raw transfer]




KEU_N_14(1RBQ)

[Raw transfer]




KEU_H_8(1RBY)

[Raw transfer]




KT5_H_8(1RBM)

[Raw transfer]




KEU_F_6(1NJS)
PUR2_HUMAN
[Raw transfer]




KEU_F_6(1RBY)
PUR2_HUMAN
[Raw transfer]




KEU_E_5(1RBY)
PUR2_HUMAN
[Raw transfer]




KT5_C_3(1RC0)
PUR2_HUMAN
[Raw transfer]




KT3_E_5(1RC1)
PUR2_HUMAN
[Raw transfer]




KEU_M_13(1RBQ)
PUR2_HUMAN
[Raw transfer]




KEU_G_7(1NJS)

[Raw transfer]




KT5_D_4(1RC0)

[Raw transfer]




KT3_F_6(1RC1)

[Raw transfer]




KEU_G_7(1RBY)
PUR2_HUMAN
[Raw transfer]




KT5_D_4(1RBZ)

[Raw transfer]




GOL_A_5(3KCQ)
?
[Raw transfer]




GOL_A_5(3KCQ)
?
[Raw transfer]




GOL_B_6(3KCQ)
?
[Raw transfer]




GOL_E_5(1MEJ)
PUR2_HUMAN
[Raw transfer]




GOL_A_6(4DS3)
?
[Raw transfer]




GOL_C_7(3KCQ)
?
[Raw transfer]




GOL_F_6(1MEJ)

[Raw transfer]




GOL_D_8(3KCQ)
?
[Raw transfer]




DXZ_A_5(4EW3)

[Raw transfer]




DXY_A_5(4EW2)

[Raw transfer]




138_E_5(1JKX)
PUR3_ECOLI
[Raw transfer]




DQB_C_3(1ZLY)

[Raw transfer]




GAR_D_4(1MEN)
PUR2_HUMAN
[Raw transfer]




GAR_F_6(1MEN)

[Raw transfer]




GAR_E_5(1MEN)
PUR2_HUMAN
[Raw transfer]




GAR_F_6(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_F_6(1C2T)
PUR3_ECOLI
[Raw transfer]




BME_E_5(1S3I)
AL1L1_RAT
[Raw transfer]




110 HHSearch 98.5459%-146 - C4 -3KCQ 2.6 ?
1 PsiBlast_PDB 98.1658%-146 - C4 -3KCQ 2.6 ?
22 PsiBlast_CBE 97.8658%-143 - C4 -3KCQ 2.4 ?
23 PsiBlast_CBE 97.5258%-145 - C4 -3KCQ 2.3 ?
21 PsiBlast_CBE 96.4358%-145 - C4 -3KCQ 2.8 ?
8 PsiBlast_PDB 92.2550%-141 - C4 -1RBY 7.7 PUR2_HUMAN
11 PsiBlast_PDB 92.1250%-143 - C4 -1RC1 7.5 PUR2_HUMAN
36 PsiBlast_CBE 92.1150%-142 - C4 -1RBQ 6.5 PUR2_HUMAN
14 PsiBlast_PDB 92.1050%-142 - C4 -4EW3 6.7
5 PsiBlast_PDB 91.9350%-140 - C4 -1NJS 7.1 PUR2_HUMAN
25 PsiBlast_CBE 91.9049%-146 - C4 -1MEN 3.4 PUR2_HUMAN
33 PsiBlast_CBE 91.8950%-142 - C4 -1RBY 6.4 PUR2_HUMAN
27 PsiBlast_CBE 91.7749%-146 - C4 -1MEJ 1.9 PUR2_HUMAN
4 PsiBlast_PDB 91.6050%-147 - C4 -1MEO - -
28 PsiBlast_CBE 91.5950%-144 - C4 -1RC1 7.0
30 PsiBlast_CBE 91.5850%-140 - C4 -1RBZ 7.1
9 PsiBlast_PDB 91.5750%-139 - C4 -1RBZ 7.2 PUR2_HUMAN
2 PsiBlast_PDB 91.5749%-148 - C4 -1MEJ - PUR2_HUMAN -
24 PsiBlast_CBE 91.5649%-143 - C4 -1MEN 3.8
6 PsiBlast_PDB 91.5650%-141 - C4 -1RBM 6.6 PUR2_HUMAN
3 PsiBlast_PDB 91.5049%-141 - C4 -1MEN 3.9 PUR2_HUMAN
13 PsiBlast_PDB 91.4950%-146 - C4 -4EW2 6.5
7 PsiBlast_PDB 91.4150%-142 - C4 -1RBQ 6.7 PUR2_HUMAN
15 PsiBlast_PDB 91.3850%-145 - C4 -1ZLY 5.1
35 PsiBlast_CBE 91.2850%-141 - C4 -1RBQ 6.5 PUR2_HUMAN
26 PsiBlast_CBE 91.2249%-143 - C4 -1MEJ 1.9
34 PsiBlast_CBE 91.2050%-139 - C4 -1RBQ 6.6
31 PsiBlast_CBE 91.1750%-138 - C4 -1RBY 7.0
29 PsiBlast_CBE 91.1350%-138 - C4 -1RC0 5.3
10 PsiBlast_PDB 91.0550%-141 - C4 -1RC0 5.7 PUR2_HUMAN
32 PsiBlast_CBE 90.9350%-140 - C4 -1RBY 5.9 PUR2_HUMAN
37 PsiBlast_CBE 90.5250%-140 - C4 -1RBM 7.3
38 PsiBlast_CBE 90.5150%-144 - C4 -1NJS 6.7
18 PsiBlast_PDB 89.3946%-137 - C4 -4DS3 2.8 ?
113 HHSearch 86.2936%-144 - C4 -1JKX 9.0 PUR3_ECOLI
41 PsiBlast_CBE 74.9839%-128 - C4 -1C3E 3.0 PUR3_ECOLI
57 PsiBlast_CBE 74.7939%-127 - C4 -1C2T 3.1 PUR3_ECOLI
56 PsiBlast_CBE 74.6839%-126 - C4 -1C2T 2.7 PUR3_ECOLI
40 PsiBlast_CBE 74.5139%-125 - C4 -1C3E 2.8 PUR3_ECOLI