@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0470: (2015-12-01 )
MAISLLQGKKGLITGIINKRSIAYGIVKTLSEHGAESAVTYQNEIVKERLLSIAAELNVELVLNCDVANEGTIDDVFKSIEEKWGTLDFLVHAIAFSDKNELSGKYVNTSLNNFQNAMNISCYSFTALAQRAEKMMPNGGSLLTLSYYGAEKVMPNYNVMGLCKAALEASVKYLACDLGPQNIRVNAISAGPIRTLASSGISDFHFISEWNRNNSPLRRNTTLEDVGKAALYLLSDLSSGTTGEILHVDSGYNVVGMKAIDSNIINSYQN

Atome Classification :

(78 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_5(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_D_11(2PD3)
FABI_HELPY
[Raw transfer]




NAD_A_3(1C14)
FABI_ECOLI
[Raw transfer]




NAD_B_4(1D8A)
FABI_ECOLI
[Raw transfer]




NAD_A_3(1D8A)
FABI_ECOLI
[Raw transfer]




NAD_C_9(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_B_5(4D46)
?
[Raw transfer]




NAD_D_9(2WYV)
?
[Raw transfer]




NAD_B_7(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_B_5(1C14)
FABI_ECOLI
[Raw transfer]




NAD_D_11(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_C_9(2QIO)
?
[Raw transfer]




NAD_I_9(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_G_7(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_A_2(3OIG)
FABI_BACSU
[Raw transfer]




NDP_C_12(3OJF)
FABI_BACCR
[Raw transfer]




NAD_D_7(3OIF)
FABI_BACSU
[Raw transfer]




NAD_E_5(1I30)
FABI_ECOLI
[Raw transfer]




NAD_G_7(1MFP)
FABI_ECOLI
[Raw transfer]




NDP_D_8(3OJF)
FABI_BACCR
[Raw transfer]




NAD_I_9(1I2Z)
FABI_ECOLI
[Raw transfer]




NAD_B_6(2PD4)
FABI_HELPY
[Raw transfer]




NAD_A_5(2PD3)
FABI_HELPY
[Raw transfer]




NAD_B_7(2WYW)
?
[Raw transfer]




NAD_D_8(2PD4)
FABI_HELPY
[Raw transfer]




NAD_G_7(1I30)
FABI_ECOLI
[Raw transfer]




NAD_D_11(2WYW)
?
[Raw transfer]




NAD_C_9(2PD3)
FABI_HELPY
[Raw transfer]




NAD_B_5(3PJF)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFH)
FABI_ECOLI
[Raw transfer]




NAD_A_5(2WYW)
?
[Raw transfer]




NAD_E_5(1LX6)
FABI_ECOLI
[Raw transfer]




NAD_C_7(2PD4)
FABI_HELPY
[Raw transfer]




NAD_D_11(2QIO)
?
[Raw transfer]




NAD_B_7(2PD3)
FABI_HELPY
[Raw transfer]




NAI_A_4(4CV3)
?
[Raw transfer]




NAD_C_9(2WYW)
?
[Raw transfer]




NAD_B_9(1DFH)
FABI_ECOLI
[Raw transfer]




NAD_A_5(2PD4)
FABI_HELPY
[Raw transfer]




NAD_A_5(3OIF)
FABI_BACSU
[Raw transfer]




NDP_A_6(3OJF)
FABI_BACCR
[Raw transfer]




NAD_A_3(4D46)
?
[Raw transfer]




NDP_B_10(3OJF)
FABI_BACCR
[Raw transfer]




NAI_B_5(4CV2)
?
[Raw transfer]




NAD_A_4(4JX8)
FABI_ECOLI
[Raw transfer]




NAD_A_3(3PJD)
FABI_ECOLI
[Raw transfer]




NAD_B_9(1DFG)
FABI_ECOLI
[Raw transfer]




NAD_A_3(3PJE)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1I2Z)
FABI_ECOLI
[Raw transfer]




NAI_B_6(4CV3)
?
[Raw transfer]




NAD_B_5(3PJE)
FABI_ECOLI
[Raw transfer]




NAD_I_9(1LX6)
FABI_ECOLI
[Raw transfer]




0WE_A_4(4JQC)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFG)
FABI_ECOLI
[Raw transfer]




IDN_M_13(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_B_5(3PJD)
FABI_ECOLI
[Raw transfer]




NAI_A_3(4CV2)
?
[Raw transfer]




NAD_A_3(4JQC)
FABI_ECOLI
[Raw transfer]




AE6_A_3(4JX8)
FABI_ECOLI
[Raw transfer]




AYM_K_11(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1LXC)
FABI_ECOLI
[Raw transfer]




IDN_K_11(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_A_2(4ZJU)
?
[Raw transfer]




NAD_B_6(2WYV)
?
[Raw transfer]




NAI_A_2(4BKU)
?
[Raw transfer]




IMJ_A_3(3OIG)
FABI_BACSU
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_D_8(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_C_7(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_A_3(3PJF)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_B_6(1DFI)
FABI_ECOLI
[Raw transfer]




DCN_D_12(2PD4)
FABI_HELPY
[Raw transfer]




DCN_B_10(2PD4)
FABI_HELPY
[Raw transfer]




J47_A_4(4D46)
?
[Raw transfer]




J47_B_6(4D46)
?
[Raw transfer]




826_K_11(1I30)
FABI_ECOLI
[Raw transfer]




EDO_B_8(3K2E)
?
[Raw transfer]




654_G_7(1I2Z)
FABI_ECOLI
[Raw transfer]




826_I_9(1I30)
FABI_ECOLI
[Raw transfer]




EDO_A_4(3K2E)
?
[Raw transfer]




NAD_A_3(3K31)
?
[Raw transfer]




1 PsiBlast_PDB 93.7865%-111 - C1 -3K2E 2.3 ?
2 PsiBlast_PDB 92.9065%-110 - C1 -3K31 4.6 ?
21 PsiBlast_CBE 92.3665%-108 - C1 -3K31 - ? -
22 PsiBlast_CBE 92.1565%-108 - C1 -3K2E 2.4 ?
3 PsiBlast_PDB 90.0662%-109 - C1 -3GRK - ? -
30 PsiBlast_CBE 87.8651%-110 - C1 -4NK4 - ? -
95 PsiBlast_CBE 87.8048%-108 - C1 -3OJF 9.4 FABI_BACCR
69 PsiBlast_CBE 87.7251%-105 - C1 -2PD4 7.2 FABI_HELPY
27 PsiBlast_CBE 87.4251%-108 - C1 -4NK4 - ? -
74 PsiBlast_CBE 87.2351%-107 - C1 -2PD3 10.1 FABI_HELPY
5 PsiBlast_PDB 87.0451%-108 - C1 -4NK4 - ? -
76 PsiBlast_CBE 86.9051%-106 - C1 -2PD3 6.4 FABI_HELPY
75 PsiBlast_CBE 86.8551%-102 - C1 -2PD3 9.5 FABI_HELPY
25 PsiBlast_CBE 86.7851%-109 - C1 -4NK5 - ? -
28 PsiBlast_CBE 86.6851%-108 - C1 -4NK4 - ? -
71 PsiBlast_CBE 86.6251%-105 - C1 -2PD4 10.5 FABI_HELPY
29 PsiBlast_CBE 86.4251%-108 - C1 -4NK4 - ? -
73 PsiBlast_CBE 86.3751%-106 - C1 -2PD3 10.2 FABI_HELPY
72 PsiBlast_CBE 86.2951%-104 - C1 -2PD4 8.2 FABI_HELPY
26 PsiBlast_CBE 86.2651%-109 - C1 -4NK4 - ? -
70 PsiBlast_CBE 86.2551%-104 - C1 -2PD4 10.7 FABI_HELPY
7 PsiBlast_PDB 85.6950%-106 - C1 -4BKU 7.8 ?
11 PsiBlast_PDB 85.5548%-107 - C1 -1I2Z 8.9 FABI_ECOLI
64 PsiBlast_CBE 85.1348%-103 - C1 -1DFH 7.1 FABI_ECOLI
47 PsiBlast_CBE 85.0648%-111 - C1 -4D46 7.9 ?
66 PsiBlast_CBE 85.0248%-106 - C1 -1DFG 9.6 FABI_ECOLI
17 PsiBlast_PDB 85.0148%-107 - C1 -4JQC 8.5 FABI_ECOLI
9 PsiBlast_PDB 84.7349%-108 - C1 -3PJD 10.1 FABI_ECOLI
50 PsiBlast_CBE 84.7248%-110 - C1 -4CV3 9.9 ?
10 PsiBlast_PDB 84.6048%-107 - C1 -1C14 7.9 FABI_ECOLI
83 PsiBlast_CBE 84.5845%-104 * C1 *2WYW 10.4 ?
79 PsiBlast_CBE 84.5751%-102 - C1 -3OIF 7.7 FABI_BACSU
49 PsiBlast_CBE 84.5748%-111 - C1 -4CV3 7.4 ?
33 PsiBlast_CBE 84.5548%-104 - C1 -1MFP 10.2 FABI_ECOLI
56 PsiBlast_CBE 84.5248%-107 - C1 -1QG6 10.4 FABI_ECOLI
67 PsiBlast_CBE 84.4948%-107 - C1 -1D8A 9.0 FABI_ECOLI
52 PsiBlast_CBE 84.4748%-111 - C1 -4CV2 6.7 ?
80 PsiBlast_CBE 84.4450%-105 - C1 -4ZJU 7.5 ?
98 PsiBlast_CBE 84.4248%-105 - C1 -3OJF 8.4 FABI_BACCR
55 PsiBlast_CBE 84.4148%-107 - C1 -1QG6 10.5 FABI_ECOLI
54 PsiBlast_CBE 84.3648%-107 - C1 -3PJF 7.4 FABI_ECOLI
97 PsiBlast_CBE 84.3048%-108 - C1 -3OJF 6.7 FABI_BACCR
58 PsiBlast_CBE 84.3048%-107 - C1 -1QG6 10.4 FABI_ECOLI
48 PsiBlast_CBE 84.2948%-113 - C1 -4D46 6.9 ?
32 PsiBlast_CBE 84.2549%-105 - C1 -3PJD 10.8 FABI_ECOLI
53 PsiBlast_CBE 84.1948%-106 - C1 -3PJF 10.4 FABI_ECOLI
65 PsiBlast_CBE 84.1548%-104 - C1 -1DFG 6.9 FABI_ECOLI
36 PsiBlast_CBE 84.0548%-107 - C1 -1I30 6.9 FABI_ECOLI
38 PsiBlast_CBE 84.0048%-106 - C1 -1C14 11.3 FABI_ECOLI
35 PsiBlast_CBE 83.9948%-106 - C1 -1LX6 6.9 FABI_ECOLI
99 PsiBlast_CBE 83.9048%-106 - C1 -2QIO 7.5 ?
100 PsiBlast_CBE 83.8748%-104 - C1 -2QIO 10.8 ?
37 PsiBlast_CBE 83.8748%-107 - C1 -1I2Z 10.9 FABI_ECOLI
87 PsiBlast_CBE 83.8045%-102 - C1 -2WYV 11.2 ?
68 PsiBlast_CBE 83.8048%-104 - C1 -1D8A 9.8 FABI_ECOLI
85 PsiBlast_CBE 83.7845%-101 - C1 -2WYW 9.7 ?
51 PsiBlast_CBE 83.7848%-112 - C1 -4CV2 7.1 ?
13 PsiBlast_PDB 83.7548%-108 - C1 -1LX6 7.5 FABI_ECOLI
20 PsiBlast_PDB 83.7048%-108 - C1 -3PJE 10.4 FABI_ECOLI
96 PsiBlast_CBE 83.6648%-106 - C1 -3OJF 5.0 FABI_BACCR
77 PsiBlast_CBE 83.5951%-102 - C1 -3OIG 8.8 FABI_BACSU
46 PsiBlast_CBE 83.4048%-105 - C1 -3PJE 8.7 FABI_ECOLI
86 PsiBlast_CBE 83.3545%-103 - C1 -2WYW 9.9 ?
60 PsiBlast_CBE 83.2448%-107 - C1 -1DFI 6.8 FABI_ECOLI
62 PsiBlast_CBE 83.1748%-108 - C1 -1DFI 6.8 FABI_ECOLI
57 PsiBlast_CBE 83.0748%-107 - C1 -1QG6 10.5 FABI_ECOLI
34 PsiBlast_CBE 82.9948%-103 - C1 -1LXC 9.7 FABI_ECOLI
63 PsiBlast_CBE 82.8448%-104 - C1 -1DFH 7.2 FABI_ECOLI
78 PsiBlast_CBE 82.7451%-101 - C1 -3OIF 5.7 FABI_BACSU
61 PsiBlast_CBE 82.7348%-108 - C1 -1DFI 6.1 FABI_ECOLI
15 PsiBlast_PDB 82.5848%-106 - C1 -1MFP 10.1 FABI_ECOLI
12 PsiBlast_PDB 82.5748%-106 - C1 -1I30 8.0 FABI_ECOLI
18 PsiBlast_PDB 82.5148%-105 - C1 -4JX8 8.4 FABI_ECOLI
89 PsiBlast_CBE 82.4745%-101 - C1 -2WYV 7.2 ?
84 PsiBlast_CBE 81.9745%-101 - C1 -2WYW 9.0 ?
59 PsiBlast_CBE 81.6348%-102 - C1 -1DFI 5.2 FABI_ECOLI
14 PsiBlast_PDB 81.0248%-105 - C1 -1LXC 6.8 FABI_ECOLI
123 Fugue 77.5145%-120 - C1 -1DFI 6.4 FABI_ECOLI