@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0474: (2015-12-01 )
MKEQDKIFTNLSGKETPLLKGAKKRGSWQKTKELLDLGSEKIIDEVRKSGLRGRGGAGFSTGLKWSFMPKNPSKEQPTYLVVNADESEPGTCKDRDILRYEPHKLLEGVLLASRAISASVAYIYIRGEFYNEYLVLKQALEEAYKEGLIGKNACKSSYDLNVFIHRGAGAYICGEETAQLESIEGKKGFPRMKPPFPAGVGLFGCPTTINNVETIAMVPDILYRGGEWFASLGKPNNTGTKIFCVSGHVNNPCNVEEELGIPLRELIEEYAGGVRGGWDNLLAVIPGGSSVSLIPKSICDIIKMDFDSLRAAQSGLGTAAVIVMDKSTDIIAAIERLSHFYMHESCGQCTPCREGTGWMWRIMKRMVTGNIKHGEIDKLLDLTTQIEGNTICALGDAAAWPIQGLIRHFRHVIEERAITKLSVY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SF4_R_(2FUG)
NQO1_THET8
[Raw transfer]




16 PsiBlast_CBE 98.1845% -91 * C4 *3M9S - NQO1_THET8 -
53 Fugue 97.9544% -85 - C4 -2FUG - ? -
20 PsiBlast_CBE 97.9145% -91 - C4 -3IAM - NQO1_THET8 -
21 PsiBlast_CBE 97.8845% -91 - C4 -3I9V - NQO1_THET8 -
23 PsiBlast_CBE 97.7745% -96 - C4 -2FUG 3.9 NQO1_THET8
24 HHSearch 97.3646% 0 - C- -3I9V - NQO15_THET8 (first) -
7 PsiBlast_PDB 96.8045% 0 - C- -4HEA - NQO10_THET8 (first) -
6 PsiBlast_PDB 96.8045% 0 - C- -2YBB - COX1_BOVIN (first) -
5 PsiBlast_PDB 96.8045% 0 - C- -3M9S - NQO15_THET8 (first) -
4 PsiBlast_PDB 96.8045% 0 - C- -3IAS - NQO15_THET8 (first) -
3 PsiBlast_PDB 96.8045% 0 - C- -3IAM - NQO15_THET8 (first) -
2 PsiBlast_PDB 96.8045% 0 - C- -3I9V - NQO15_THET8 (first) -
1 PsiBlast_PDB 96.8045% 0 - C- -2FUG - NQO15_THET8 (first) -
54 Fugue 54.0818% -44 * C6 *4ARZ - GTR2_YEAST -
56 Fugue 50.5915% -42 - C6 -1C3J - GSTB_BPT4 -
60 Fugue 48.9219% -32 - C6 -4Q05 - ? -
61 Fugue 45.3119% 6 - C2 -5CD6 - ? -
29 HHSearch 40.5719% -79 - C5 -3CF4 - ? -
9 PsiBlast_PDB 40.1534% -63 - C5 -4COG - KYNB_BURCJ -
58 Fugue 39.6013% 24 - C4 -1BGX - DPO1_THEAQ -